NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043952

Metagenome / Metatranscriptome Family F043952

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043952
Family Type Metagenome / Metatranscriptome
Number of Sequences 155
Average Sequence Length 75 residues
Representative Sequence YLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGAYSGKLGIRSNLDVTNVIGAFRVNLTL
Number of Associated Samples 139
Number of Associated Scaffolds 155

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 1.30 %
% of genes near scaffold ends (potentially truncated) 94.84 %
% of genes from short scaffolds (< 2000 bps) 91.61 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (98.065 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater
(19.355 % of family members)
Environment Ontology (ENVO) Unclassified
(38.065 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.129 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 59.15%    Coil/Unstructured: 40.85%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 155 Family Scaffolds
PF05065Phage_capsid 7.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 155 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 7.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.35 %
UnclassifiedrootN/A0.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000367|SS_2KS_010_SOILDRAFT_10163635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300000563|SL_3KL_010_SEDDRAFT_10216887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage813Open in IMG/M
3300002161|JGI24766J26685_10099332All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage620Open in IMG/M
3300002303|B570J29644_1004712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage933Open in IMG/M
3300002408|B570J29032_109487747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300002835|B570J40625_100360450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1436Open in IMG/M
3300003388|JGI25910J50241_10073584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage993Open in IMG/M
3300003684|Ga0005851_1034230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1413Open in IMG/M
3300004112|Ga0065166_10511973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300004768|Ga0007762_1615496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300004800|Ga0058861_10752025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage919Open in IMG/M
3300005417|Ga0068884_1472272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300005662|Ga0078894_10053996All Organisms → cellular organisms → Bacteria3416Open in IMG/M
3300005662|Ga0078894_11287596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300005805|Ga0079957_1084193All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1786Open in IMG/M
3300006392|Ga0075507_1001618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300006400|Ga0075503_1013554All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1192Open in IMG/M
3300006425|Ga0075486_1688142All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300006802|Ga0070749_10303024All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage895Open in IMG/M
3300006868|Ga0075481_10331104All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300006919|Ga0070746_10477910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300007321|Ga0102692_1046674All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1250Open in IMG/M
3300007344|Ga0070745_1245350All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300007545|Ga0102873_1061258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1147Open in IMG/M
3300007630|Ga0102903_1121158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
3300007634|Ga0102901_1110532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300007670|Ga0102862_1101821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
3300007972|Ga0105745_1153539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage707Open in IMG/M
3300007973|Ga0105746_1199893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage683Open in IMG/M
3300008055|Ga0108970_10164789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1488Open in IMG/M
3300008108|Ga0114341_10278210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage884Open in IMG/M
3300008110|Ga0114343_1045109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1737Open in IMG/M
3300008110|Ga0114343_1200865All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300008120|Ga0114355_1178719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage714Open in IMG/M
3300008263|Ga0114349_1230085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage630Open in IMG/M
3300008266|Ga0114363_1095072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2052Open in IMG/M
3300008448|Ga0114876_1192604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage697Open in IMG/M
3300009056|Ga0102860_1264326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300009239|Ga0103858_10027285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1288Open in IMG/M
3300010293|Ga0116204_1217468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300010296|Ga0129348_1225715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300010299|Ga0129342_1252686All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300010354|Ga0129333_10025744All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5574Open in IMG/M
3300010354|Ga0129333_10706198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage866Open in IMG/M
3300010370|Ga0129336_10417957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage730Open in IMG/M
3300011120|Ga0150983_10936789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1331Open in IMG/M
3300011187|Ga0136596_1049864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage889Open in IMG/M
3300012520|Ga0129344_1171761All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300012520|Ga0129344_1172959All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300012528|Ga0129352_10326691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300012706|Ga0157627_1201763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1043Open in IMG/M
3300012711|Ga0157607_1138155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300012721|Ga0157612_1258002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage673Open in IMG/M
3300012724|Ga0157611_1223029All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300012725|Ga0157610_1144078All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1066Open in IMG/M
3300012731|Ga0157616_1067276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300012752|Ga0157629_1161180All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage923Open in IMG/M
3300012959|Ga0157620_1012635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage719Open in IMG/M
3300012962|Ga0129335_1104338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300012962|Ga0129335_1213676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage673Open in IMG/M
3300012968|Ga0129337_1312464All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1371Open in IMG/M
3300012968|Ga0129337_1367960All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1337Open in IMG/M
3300012968|Ga0129337_1443943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300012970|Ga0129338_1149670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1364Open in IMG/M
3300012970|Ga0129338_1389799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1863Open in IMG/M
3300012970|Ga0129338_1505058All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage832Open in IMG/M
3300013004|Ga0164293_10100756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2218Open in IMG/M
(restricted) 3300014720|Ga0172376_10153460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1531Open in IMG/M
3300016697|Ga0180057_1179338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1376Open in IMG/M
3300016747|Ga0182078_10003016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage710Open in IMG/M
3300017969|Ga0181585_10821497All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300018418|Ga0181567_10871248All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300018424|Ga0181591_10615191All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage776Open in IMG/M
3300019274|Ga0182073_1349431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage713Open in IMG/M
3300020083|Ga0194111_10315155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1070Open in IMG/M
3300020109|Ga0194112_10892127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300020196|Ga0194124_10232912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage927Open in IMG/M
3300020196|Ga0194124_10371589All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300020196|Ga0194124_10386256All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300020200|Ga0194121_10048523All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3395Open in IMG/M
3300020220|Ga0194119_10377283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage925Open in IMG/M
3300020221|Ga0194127_10606448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage696Open in IMG/M
3300020222|Ga0194125_10523538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300020222|Ga0194125_10588999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300020528|Ga0208224_1000637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6287Open in IMG/M
3300020549|Ga0207942_1037584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300020571|Ga0208723_1034216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage740Open in IMG/M
3300021376|Ga0194130_10012718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8023Open in IMG/M
3300021376|Ga0194130_10071973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2352Open in IMG/M
3300021424|Ga0194117_10279925All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage794Open in IMG/M
3300021962|Ga0222713_10467635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage761Open in IMG/M
3300022407|Ga0181351_1057995All Organisms → Viruses → Predicted Viral1600Open in IMG/M
3300022748|Ga0228702_1026771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1801Open in IMG/M
3300022937|Ga0255770_10275642All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage791Open in IMG/M
3300024483|Ga0255224_1055085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M
3300024484|Ga0256332_1040325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1003Open in IMG/M
3300024485|Ga0256318_1018859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1412Open in IMG/M
3300024487|Ga0255222_1079693All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300024515|Ga0255183_1081860All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300024533|Ga0256299_1038781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage934Open in IMG/M
3300024536|Ga0256338_1022208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1414Open in IMG/M
3300024539|Ga0255231_1040490All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300024545|Ga0256347_1105901All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage587Open in IMG/M
3300024546|Ga0256356_1015497All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1359Open in IMG/M
3300024558|Ga0255232_1125193All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300024559|Ga0255284_1105359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300024569|Ga0255243_1033057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1334Open in IMG/M
3300024569|Ga0255243_1181998All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300024848|Ga0255229_1095452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300024852|Ga0255295_1081346All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300025646|Ga0208161_1018737All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2648Open in IMG/M
3300025647|Ga0208160_1083309All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage853Open in IMG/M
3300025687|Ga0208019_1174269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300025732|Ga0208784_1158153All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
3300025753|Ga0255235_1059358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300026425|Ga0256300_1055727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage565Open in IMG/M
3300026562|Ga0255285_1053763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage797Open in IMG/M
3300026565|Ga0256311_1109523All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300026566|Ga0256334_1060092All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage869Open in IMG/M
3300026567|Ga0256303_1055860All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage852Open in IMG/M
3300026569|Ga0255277_1038731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1251Open in IMG/M
3300026573|Ga0255269_1175562All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300027156|Ga0255078_1113175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300027242|Ga0208806_1091092All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300027260|Ga0208027_1010886All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1897Open in IMG/M
3300027578|Ga0255075_1016043All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1482Open in IMG/M
3300027644|Ga0209356_1071549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1045Open in IMG/M
3300027733|Ga0209297_1133830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1032Open in IMG/M
3300027744|Ga0209355_1256707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage683Open in IMG/M
3300027782|Ga0209500_10149428All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1101Open in IMG/M
3300027785|Ga0209246_10194749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage793Open in IMG/M
3300027805|Ga0209229_10359472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300028101|Ga0256349_1012571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1399Open in IMG/M
3300028112|Ga0256335_1047125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1140Open in IMG/M
3300028113|Ga0255234_1097545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage775Open in IMG/M
3300028286|Ga0256331_1146512All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300028329|Ga0210315_1016476All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage906Open in IMG/M
3300031093|Ga0308197_10302569All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage590Open in IMG/M
3300031758|Ga0315907_10566709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage887Open in IMG/M
3300031758|Ga0315907_10984719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage610Open in IMG/M
3300031857|Ga0315909_10012199All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9020Open in IMG/M
3300032050|Ga0315906_10637682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage869Open in IMG/M
3300033981|Ga0334982_0243230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage868Open in IMG/M
3300033993|Ga0334994_0227134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage992Open in IMG/M
3300034018|Ga0334985_0480053All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
3300034018|Ga0334985_0522358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300034066|Ga0335019_0448156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300034068|Ga0334990_0356938All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage791Open in IMG/M
3300034071|Ga0335028_0054096All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2715Open in IMG/M
3300034093|Ga0335012_0339832All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage750Open in IMG/M
3300034103|Ga0335030_0504406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300034105|Ga0335035_0442972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage725Open in IMG/M
3300034168|Ga0335061_0036320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2637Open in IMG/M
3300034200|Ga0335065_0226357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1209Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater19.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater14.84%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.19%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake9.03%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake7.10%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.16%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.23%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.23%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.87%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.58%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.94%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.29%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.29%
Alkaline SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment1.29%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.65%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.65%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water0.65%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.65%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.65%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.65%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.65%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.65%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000367Alkaline soda soil microbial communities from Kulunda Steppe, Russia - 2KS_010_SOILEnvironmentalOpen in IMG/M
3300000563Alkaline sediment microbial communities from Cock Soda Lake, Kulunda Steppe, Russia - 3KL_010_SEDEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002303Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion nsEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003684Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004768Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005417Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006425Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007321Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009239Microbial communities of water from Amazon river, Brazil - RCM11EnvironmentalOpen in IMG/M
3300010293Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011187Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012706Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012711Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012721Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012752Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012959Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES150 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300016697Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016747Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020528Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020571Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022748Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MGEnvironmentalOpen in IMG/M
3300022937Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaGEnvironmentalOpen in IMG/M
3300024483Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024484Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024485Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024487Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024515Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8dEnvironmentalOpen in IMG/M
3300024533Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024536Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024539Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024545Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024546Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024558Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024559Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024569Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024848Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024852Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025753Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026425Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026562Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026565Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026566Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026567Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026569Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027156Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027242Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027260Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027578Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027744Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300028101Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028112Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028286Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028329Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SS_2KS_010_SOILDRAFT_1016363523300000367Alkaline SedimentVGKVIAVEKFAENFDDGLLSYMQLPKDPGAVKEVYSLTKEGPYSGQLGIRANLDVTNVVGAVRVNLTL*
SL_3KL_010_SEDDRAFT_1021688713300000563Alkaline SedimentAANFGLVVGKVVVVEKFATNFDDGLLSYMQLPSDPGAVKEVYSLTKAGTYQGRLGIRANLDVENVVGAMRVNLTL*
JGI24766J26685_1009933213300002161Freshwater And SedimentAAAGAYPWTVVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL*
B570J29644_100471223300002303FreshwaterPHLIVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL*
B570J29032_10948774723300002408FreshwaterVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL*
B570J40625_10036045023300002835FreshwaterLCGTNPYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL*
JGI25910J50241_1007358423300003388Freshwater LakeSTTAAGAYPWLQVGKVVEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL*
Ga0005851_103423013300003684Freshwater And SedimentVTLTTALCGTNPYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVFEVTKAGTYQGKLGIRSNLDVTNVLGAFRVNLTL*
Ga0065166_1051197323300004112Freshwater LakeQFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSYSGKLGIRSNLDVTNVVGAFRVNLTL
Ga0007762_161549613300004768Freshwater LakeADFLNSADVYSYLQVGKVIEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRSGAYSGKLGIRSNLDVTNVIGAFRVNLTL*
Ga0058861_1075202523300004800Host-AssociatedEASNYPQTIIGKVVEIEKFATNFDDGLLSYMILPSDPGALKTVFEITQAGTYQGKLGIRSNLDVANVTGAFRVSLSL*
Ga0068884_147227213300005417Freshwater LakeYSYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRAGTYSGKLGIRSNLDVHNVIGAFRVNLTI*
Ga0078894_1005399613300005662Freshwater LakeYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0078894_1128759613300005662Freshwater LakeYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSYSGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0079957_108419313300005805LakePRALSSGDAGTYPWLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRAGAFSGKLGIRANLDVNNVIGAFRVNLTL*
Ga0075507_100161823300006392AqueousEKFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0075503_101355423300006400AqueousFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0075486_168814223300006425AqueousHLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRDGDYKGKLGIRANLDVNNVVGAFRVNLTL*
Ga0070749_1030302413300006802AqueousAEQLNSSAVYSHLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRDGDYKGKLGIRANLDVNNVVGAFRVNLTL*
Ga0075481_1033110413300006868AqueousKLTAAEQYNSSAVYSHLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGDYTGKLGIRANLDVNNVIGAFRVNLTL*
Ga0070746_1047791013300006919AqueousMGRPVLASKSEIAAAPYIQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRANLDVHNVVGAFRVNLTL*
Ga0102692_104667423300007321Freshwater LakeFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSYSGKLGIRANLDVYNVIGAFRVNLTL*
Ga0070745_124535023300007344AqueousVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0102873_106125813300007545EstuarineMGRPVLAAATDFLDSSSVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL*
Ga0102903_112115823300007630EstuarineGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRANLDVTNVIGAFRVNLTL*
Ga0102901_111053213300007634EstuarineGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL*
Ga0102862_110182123300007670EstuarineGAYPWLQVGKVVEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL*
Ga0105745_115353913300007972Estuary WaterVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0105746_119989323300007973Estuary WaterYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGSFSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0108970_1016478923300008055EstuaryVGKVVEVEKFLTNFDDGLLSYMQLPSDPGALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0114341_1027821013300008108Freshwater, PlanktonSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGAFSGKLRIRSNLDVHNVIGAFRVNLTL*
Ga0114343_104510933300008110Freshwater, PlanktonKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRANLDVTNVVGAFRVNLTL*
Ga0114343_120086513300008110Freshwater, PlanktonSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0114355_117871923300008120Freshwater, PlanktonSYPWLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGTYSGKLGIRANLDVNNVIGAFRVNLTL*
Ga0114349_123008523300008263Freshwater, PlanktonVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSYSGKLGIRANLDVYNVIGAFRVNLTL*
Ga0114363_109507233300008266Freshwater, PlanktonFATNFDDGLLSYMQLPSDPGALKTVYELTRSGAFSGKLGIRSNLDVTNVIGAFRVNLTL*
Ga0114876_119260413300008448Freshwater LakeSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0102860_126432623300009056EstuarineMVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGAYSGKLGIRANLDVTNVIGAFRVNLTL*
Ga0114975_1069314223300009164Freshwater LakeRAVKFTKGTDAHYLAVGTVIEVEYFATNFDDGLLSYMQLPSDPGALKEVYELTKSGPYSGKLGIRSNLDTANVVGAVRVSLTL*
Ga0103858_1002728513300009239River WaterATDFYSSSAAYAYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRGGTYSGKLGIRANLDVKNVIGAFRVNLTL*
Ga0116204_121746823300010293Anoxic Lake WaterVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0129348_122571513300010296Freshwater To Marine Saline GradientNSNAVYSHLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0129342_125268613300010299Freshwater To Marine Saline GradientLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRANLDVDHVVGAFRVNLTL*
Ga0129333_1002574413300010354Freshwater To Marine Saline GradientVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVVGAFRVNLTL*
Ga0129333_1070619823300010354Freshwater To Marine Saline GradientALSDADASDYPWLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGTYSGKLGIRANLDVNNVIGAFRVNLTL*
Ga0129336_1041795713300010370Freshwater To Marine Saline GradientVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0150983_1093678913300011120Forest SoilKVIEIEKFATNFDDGLLSYMLLPSDPGALKTVFELTKAGAYSGKLGIRANLDVANVLGAFRVVLSL*
Ga0136596_104986413300011187Saline LakeGKVIVNETFADNFDDGLLSYMQLPSDPGAVKEVYSITEAGTYQGKLGIRANLDKANVVGAFRVNLTL*
Ga0129344_117176123300012520AqueousYNSSAAYAYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRANLDVDHVVGAFRVNLTL*
Ga0129344_117295923300012520AqueousYNSSAAYAYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRNGTYSGKLGIRANLDVDNVVGAFRVNLTL*
Ga0129352_1032669123300012528AqueousFATNFDDGLLSYMQLPSDPGALKTVYELTRDGDYKGKLGIRANLDVNNVVGAFRVNLTL*
Ga0157627_120176323300012706FreshwaterRPVKAAAADFLNSTDVYSYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL*
Ga0157607_113815513300012711FreshwaterYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVVGAFRVNLTL*
Ga0157612_125800223300012721FreshwaterRPVSLTTALCGTNPYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0157611_122302913300012724FreshwaterRPVSLTTALCGINPYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0157610_114407823300012725FreshwaterDFLNSTDVYSYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0157616_106727623300012731FreshwaterRPVAIASTTGAAGAYPWTVVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL*
Ga0157629_116118023300012752FreshwaterEVEQFATNFDDGLLSYMQLPSDPGALKTVFELTRSGTFSGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0157620_101263523300012959FreshwaterFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL*
Ga0129335_110433823300012962AqueousVLAAAADFYASSAAYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRAGAFSGKLGIRSNLDVHNVVGAFRVNLTL*
Ga0129335_121367623300012962AqueousEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0129337_131246413300012968AqueousSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRAGTYAGKLGIRSNLDVNNVIGAFRVNLTL*
Ga0129337_136796023300012968AqueousYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGAYSGKLGIRSNLDVTNVIGAFRVNLTL*
Ga0129337_144394313300012968AqueousAAADFYNSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0129338_114967013300012970AqueousVLAAAGDFYNSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRSNLDVTNVIGAFRVNLTL*
Ga0129338_138979933300012970AqueousTSTLSGTDPYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVFEVTRTGTYQGKLGIRSNLDVTNVLGAFRVNLTL*
Ga0129338_150505813300012970AqueousDFYNSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL*
Ga0164293_1010075613300013004FreshwaterEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL*
(restricted) Ga0172376_1015346013300014720FreshwaterKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGAYSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0180057_117933813300016697FreshwaterVKAAATDFLVSGTSSVYSYLQVGKVIEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL
Ga0182078_1000301623300016747Salt MarshQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRANLDVHNIVGAFRVNLTL
Ga0181585_1082149723300017969Salt MarshAVKADGTEIGNYPFLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALADVYELTKSGPNQGKLGIRSNLDVADVVGAFRVLLTL
Ga0181567_1087124823300018418Salt MarshQYNSSAVYSHLQDGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRDGDYKGKLGIRANLDVNNVVGAFRVNLTL
Ga0181591_1061519123300018424Salt MarshQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRANLDVHNVVGAFRVNLTL
Ga0182073_134943113300019274Salt MarshLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRDGDYKGKLGIRANLDVNNVVGAFRVNLTL
Ga0194111_1031515523300020083Freshwater LakeVEKFATNFDDGLLSYMQLPSDPGALKTVYEITKTGPNKGKLGIRANLDVYKVSGAFRVNLTL
Ga0194112_1089212713300020109Freshwater LakeAGDFYASSAAYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRAGTFKGKLGIRSNLDVHNVIGAFRVNLTL
Ga0194124_1023291223300020196Freshwater LakeVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0194124_1037158913300020196Freshwater LakeFDFFASNAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0194124_1038625613300020196Freshwater LakeYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYEITKTGPNKGKLGIRANLDVYKVSGAFRVNLTL
Ga0194121_1004852313300020200Freshwater LakeNYDDGLLSYMQLPSDPGALKTVFEITRSGTFSGKLGIRSNLDVHNVKGAFRVNLTL
Ga0194119_1037728323300020220Freshwater LakeLDTALCGTHPYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYEITKTGPNKGKLGIRANLDVYKVSGAFRVNLTL
Ga0194127_1060644813300020221Freshwater LakeKFATNFDDGLLSYMQLPSDPGALKTVYEITKTGPNKGKLGIRANLDVYKVSGAFRVNLTL
Ga0194125_1052353823300020222Freshwater LakeLDTALCGTHPYLQVGKVIEVEKFTTNFDDGLLSYMQLPSDPGALKTVYEITKTGPNKGKLGIRANLDVYKVSGAFRVNLTL
Ga0194125_1058899923300020222Freshwater LakeSNAAYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0208224_100063713300020528FreshwaterYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0207942_103758413300020549FreshwaterVYSYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL
Ga0208723_103421623300020571FreshwaterASTTVAGAYPWLQVGKVVEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL
Ga0194130_10012718143300021376Freshwater LakeAADFFASNAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0194130_1007197313300021376Freshwater LakeVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0194117_1027992523300021424Freshwater LakeVLTAALCGTHPYLQVGKVIEVEKFTTNFDDGLLSYMQLPSDPGALKTVYEITKTGPNKGKLGIRANLDVYKVSGAFRVNLTL
Ga0222713_1046763523300021962Estuarine WaterVIEIEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGAFSGKLGIRSNLDVTNVIGAFRVNLTL
Ga0181351_105799513300022407Freshwater LakeRPVAFAATTSAAGAYPWLQVGKVVEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL
Ga0228702_102677133300022748FreshwaterAASEFLSSSNVYSYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGSLKTVFELTRSGAYTGKLGIRSNLDVTNVIGAFRVNLTI
Ga0255770_1027564223300022937Salt MarshSHLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0255224_105508513300024483FreshwaterQFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL
Ga0256332_104032513300024484FreshwaterKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTQSGTYQGKLGIRANLDVTNVIGAFRVSLSM
Ga0256318_101885913300024485FreshwaterGRPVAFAASTTAAGAYPWLQVGKVVEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL
Ga0255222_107969313300024487FreshwaterVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRAGAFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0255183_108186023300024515FreshwaterAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0256299_103878113300024533FreshwaterSYPHLMVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVIGAFRVNLTL
Ga0256338_102220813300024536FreshwaterDFMGRPRKLSSADAGTYPWLQVGKVIEVEKFATNFDDGLLSYMLLPSDPGALKTVYELTREGSYKGKLGIRSNLDVTNVVGAFRVNLTL
Ga0255231_104049013300024539FreshwaterNMGRPVLAAASDFYNSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVTNVVGAFRVNLTL
Ga0256347_110590113300024545FreshwaterVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGTYSGKLGIRANLDVTNVIGAFRVNLTL
Ga0256356_101549723300024546FreshwaterVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0255232_112519313300024558FreshwaterPVLAAATDFYDSSAAYAYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRDGTFSGKLGIRANLDVNNVIGAFRVNLTL
Ga0255284_110535923300024559FreshwaterEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGTYSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0255243_103305713300024569FreshwaterKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL
Ga0255243_118199823300024569FreshwaterEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGSFSGKLGIRSNLDVHNVIGAFRVNLT
Ga0255229_109545223300024848FreshwaterFATNFDDGLFSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVVGAFRVNLTL
Ga0255295_108134623300024852FreshwaterEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRTGTYSGKLGIRSNLDVTNVLGAFRVNLTL
Ga0208161_101873743300025646AqueousMGRPVAAAAADFYNSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSYNGKLGIRANLDVYNVVGAFRVNLTL
Ga0208160_108330923300025647AqueousDHMGRPVAAAAADFYTTSAAHAYLQVGKVVEVETFATNFDDGLLSYMQLPSDPGALKTVYELTRNGTYSGKLGIRANLDVDNVVGAFRVNLTL
Ga0208019_117426923300025687AqueousIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSYSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0208784_115815323300025732AqueousSTLCGTDPYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRTGTYSGKLGIRSNLDVTNVLGAFRVNLTL
Ga0255235_105935813300025753FreshwaterRIFLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGSFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0256300_105572713300026425FreshwaterMGRPVLAAATDFLASSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGSFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0255285_105376323300026562FreshwaterGRPVLAAAGDFYNSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL
Ga0256311_110952323300026565FreshwaterKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTKSGTYQGKLGIRSNLDVTNVVGAFRVNLTL
Ga0256334_106009213300026566FreshwaterTNFDDGLLSYMQLPSDPGALKTVFEITRTGTYSGKLGIRSNLDVTNVLGAFRVNLTL
Ga0256303_105586023300026567FreshwaterFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0255277_103873123300026569FreshwaterWTVVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL
Ga0255269_117556213300026573FreshwaterVLAAAGDFYNSSAVYSYLQVGKVVEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL
Ga0255078_111317513300027156FreshwaterLQVGKVVEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL
Ga0208806_109109213300027242EstuarineFATNFDDGLLSYMQLPSDPGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL
Ga0208027_101088613300027260EstuarineDSSSVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTKAGPNTGKLGIRSNLDVTNVIGAFRVNLTL
Ga0255075_101604313300027578FreshwaterGKVVEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL
Ga0209356_107154923300027644Freshwater LakeVETFATNFDDGLLSYMQLPSDPGALKTVFELTRSGSFSGKLGIRSNLDVHNVKGAFRVNLTL
Ga0209297_113383023300027733Freshwater LakeADHMGRAVNLTTTLCGTNPYLQVGKVIEVETFATNFDDGLLSYMQLPSDPGALKTVFELTRSGSFSGKLGIRSNLDVHNVKGAFRVNLTL
Ga0209355_125670723300027744Freshwater LakeMGRPVTLTTALCGTNPYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVFEVTKAGTYQGKLGIRSNLDVTNVLGAFRVNLTL
Ga0209500_1014942813300027782Freshwater LakeDCGSYPWLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0209246_1019474923300027785Freshwater LakeYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL
Ga0209229_1035947223300027805Freshwater And SedimentMGRPVAIASTTAAAGAYPWTVVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL
Ga0256349_101257123300028101FreshwaterMGRARKLSTADMASYPWLCVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYEITREGTYKNKLGIRSNLDVTNVVGAFRVNLTL
Ga0256335_104712523300028112FreshwaterFMGRPRKLSSADAGTYPWLQVGKVIEVEKFATNFDDGLLSYMLLPSDPGALKTVYELTREGSYKGKLGIRSNLDVTNVVGAFRVNLTL
Ga0255234_109754523300028113FreshwaterDFLASSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGSFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0256331_114651213300028286FreshwaterGTYPWLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTQSGTYQGKLGIRANLDVTNVIGAFRVSLSM
Ga0210315_101647623300028329EstuarineLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL
Ga0308197_1030256923300031093SoilAKCSEANAAAHPQSVVGKAVEVEYFATNYDDGLLSYMQLPSDPGALQHVYELTKAGPYTGKLGIRANLDVHNVVGAVRVNLNI
Ga0315907_1056670923300031758FreshwaterATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL
Ga0315907_1098471913300031758FreshwaterYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGAFSGKLGIRSNLDVTNVIGAFRVNLTL
Ga0315909_1001219993300031857FreshwaterRPVLAAASDFYNSSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGAFSGKLGIRSNLDVTNVIGAFRVNLTL
Ga0315906_1063768223300032050FreshwaterRLLSGSDAGTYPWLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRANLDVTNVVGAFRVNLTL
Ga0334982_0243230_3_2333300033981FreshwaterAGAYPWTVVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGTYSGKLGIRSNLDVNNVVGAFRVNLTL
Ga0334994_0227134_715_9843300033993FreshwaterMGRPVAFAASTTVAGAYPWLQVGKVVEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRAGTYSGKLGIRANLDVHNVIGAFRVNLTL
Ga0334985_0480053_36_2423300034018FreshwaterVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSYSGKLGIRSNLDVTNVVGAFRVNLTL
Ga0334985_0522358_6_2183300034018FreshwaterLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITQSGPFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0335019_0448156_10_2223300034066FreshwaterLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITQSGPFNGKLGIRSNLDVNNVIGAFRVNLTL
Ga0334990_0356938_569_7903300034068FreshwaterNPYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0335028_0054096_2462_27133300034071FreshwaterVLLSDADTASFPWLLVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVFELTRAGSFTGKLGIRSNLDVNNVIGAFRVNLTL
Ga0335012_0339832_424_6993300034093FreshwaterMGRPVLAAATDFLDSSSVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTKAGPNNGKLGIRSNLDVTNVIGAFRVNLTL
Ga0335030_0504406_512_7603300034103FreshwaterTDFLASSAVYSYLQVGKVVEVEKFATNFDDGLLSYMQLPSDPGALKTVFEITRSGAFSGKLGIRSNLDVHNVIGAFRVNLTL
Ga0335035_0442972_1_2373300034105FreshwaterNSTDVYSYLQVGKVIEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSYSGKLGIRSNLDVTNVVGAFRVNLTL
Ga0335061_0036320_2387_26353300034168FreshwaterTNFLSGSDVYSYLQVGKVIEVEQFATNFDDGLLSYMQLPSDPGALKTVFELTRSGAYSGKLGIRSNLDVTNVIGAFRVNLTL
Ga0335065_0226357_831_11063300034200FreshwaterMGRPVKAAAADFINSTDVYSYLQVGKVIEVEQFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSYSGKLGIRSNLDVTNVVGAFRVNLTL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.