Metagenome / Metatranscriptome Family F045895

Basic Information
Family ID	F045895
Family Type	Metagenome / Metatranscriptome
Number of Sequences	152
Average Sequence Length	38 residues
Representative Sequence	ELDMVRAVVEEAATLASLALFLGMIAIWAQVIATL
Number of Associated Samples	132
Number of Associated Scaffolds	152

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	33.77 %
% of genes near scaffold ends (potentially truncated)	48.68 %
% of genes from short scaffolds (< 2000 bps)	88.82 %
Associated GOLD sequencing projects	128
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.61

Most Common Taxonomy
Group	Bacteria (78.289 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.474 % of family members)
Environment Ontology (ENVO)	Unclassified (22.368 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.053 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 152 Family Scaffolds
PF02811	PHP	48.68
PF07733	DNA_pol3_alpha	9.87
PF00005	ABC_tran	8.55
PF14579	HHH_6	1.97
PF02687	FtsX	1.32
PF12071	DUF3551	1.32
PF04055	Radical_SAM	1.32
PF00106	adh_short	0.66
PF06042	NTP_transf_6	0.66
PF13505	OMP_b-brl	0.66
PF00497	SBP_bac_3	0.66
PF05973	Gp49	0.66
PF11154	DUF2934	0.66
PF00318	Ribosomal_S2	0.66
PF03129	HGTP_anticodon	0.66
PF00872	Transposase_mut	0.66
PF01255	Prenyltransf	0.66
PF12704	MacB_PCD	0.66

COG ID	Name	Functional Category	% Frequency in 152 Family Scaffolds
COG0587	DNA polymerase III, alpha subunit	Replication, recombination and repair [L]	9.87
COG2176	DNA polymerase III, alpha subunit (gram-positive type)	Replication, recombination and repair [L]	9.87
COG0020	Undecaprenyl pyrophosphate synthase	Lipid transport and metabolism [I]	0.66
COG0052	Ribosomal protein S2	Translation, ribosomal structure and biogenesis [J]	0.66
COG0124	Histidyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.66
COG0423	Glycyl-tRNA synthetase, class II	Translation, ribosomal structure and biogenesis [J]	0.66
COG0441	Threonyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.66
COG0442	Prolyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.66
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.66
COG3575	Uncharacterized conserved protein	Function unknown [S]	0.66
COG3657	Putative component of the toxin-antitoxin plasmid stabilization module	Defense mechanisms [V]	0.66
COG4679	Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system	Defense mechanisms [V]	0.66

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	78.29 %
Unclassified	root	N/A	21.71 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	78.29 %
Unclassified	root	N/A	21.71 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	78.29 %
Unclassified	root	N/A	21.71 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	77.63 %
Unclassified	root	N/A	21.71 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	72.37 %
Unclassified	root	N/A	21.71 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.32 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.66 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	63.82 %
Unclassified	root	N/A	21.71 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.32 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.32 %
Vibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales	0.66 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	28.29 %
Unclassified	root	N/A	21.71 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	13.16 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.32 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.32 %
Vibrionaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.71 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	13.16 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	7.89 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	3.95 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.32 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.32 %
Vibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.71 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	11.18 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	7.89 %
Afipia felis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	1.97 %
Rhodoplanes piscinae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	1.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.32 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.32 %
Vibrio cholerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae	0.66 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.71 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	10.53 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	7.89 %
Afipia felis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	1.97 %
Rhodoplanes piscinae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	1.32 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.32 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.32 %
Rhodoplanes sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.	0.66 %
Vibrio cholerae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae	0.66 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_101558070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1102	Open in IMG/M
3300000559\|F14TC_110845103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	642	Open in IMG/M
3300000956\|JGI10216J12902_101548981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	814	Open in IMG/M
3300001661\|JGI12053J15887_10005246	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	6777	Open in IMG/M
3300002568\|C688J35102_118325531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	549	Open in IMG/M
3300002568\|C688J35102_120977883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4409	Open in IMG/M
3300004156\|Ga0062589_100335462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1191	Open in IMG/M
3300004156\|Ga0062589_100771325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	866	Open in IMG/M
3300004480\|Ga0062592_101751199	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	606	Open in IMG/M
3300004480\|Ga0062592_102432747	Not Available	526	Open in IMG/M
3300004781\|Ga0062379_10050044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	845	Open in IMG/M
3300005205\|Ga0068999_10035912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	826	Open in IMG/M
3300005332\|Ga0066388_101099062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1346	Open in IMG/M
3300005353\|Ga0070669_101654108	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	558	Open in IMG/M
3300005355\|Ga0070671_101741166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	553	Open in IMG/M
3300005553\|Ga0066695_10001873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	8659	Open in IMG/M
3300005554\|Ga0066661_10396981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	844	Open in IMG/M
3300005555\|Ga0066692_10115977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1608	Open in IMG/M
3300005560\|Ga0066670_11002518	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	510	Open in IMG/M
3300005569\|Ga0066705_10008337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4767	Open in IMG/M
3300005713\|Ga0066905_100114424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1867	Open in IMG/M
3300005764\|Ga0066903_100104890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3841	Open in IMG/M
3300005764\|Ga0066903_100675426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1813	Open in IMG/M
3300005764\|Ga0066903_101737364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1189	Open in IMG/M
3300005764\|Ga0066903_103317265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	870	Open in IMG/M
3300005764\|Ga0066903_108583806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	520	Open in IMG/M
3300005841\|Ga0068863_100627847	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1065	Open in IMG/M
3300005983\|Ga0081540_1271038	Not Available	587	Open in IMG/M
3300005985\|Ga0081539_10145465	All Organisms → cellular organisms → Bacteria → Proteobacteria	1147	Open in IMG/M
3300005985\|Ga0081539_10347168	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	624	Open in IMG/M
3300006028\|Ga0070717_10452684	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1157	Open in IMG/M
3300006038\|Ga0075365_10697380	All Organisms → cellular organisms → Bacteria → Proteobacteria	717	Open in IMG/M
3300006041\|Ga0075023_100100862	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	998	Open in IMG/M
3300006175\|Ga0070712_101865925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	526	Open in IMG/M
3300006175\|Ga0070712_101939269	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	516	Open in IMG/M
3300006755\|Ga0079222_10992629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	720	Open in IMG/M
3300006806\|Ga0079220_11485326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	580	Open in IMG/M
3300006845\|Ga0075421_100012809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	10428	Open in IMG/M
3300006853\|Ga0075420_101550271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	568	Open in IMG/M
3300006854\|Ga0075425_100339368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1730	Open in IMG/M
3300006871\|Ga0075434_102045957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	578	Open in IMG/M
3300006904\|Ga0075424_100378593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1509	Open in IMG/M
3300009012\|Ga0066710_100715039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	1528	Open in IMG/M
3300009088\|Ga0099830_11769708	Not Available	516	Open in IMG/M
3300009089\|Ga0099828_10824841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	830	Open in IMG/M
3300009090\|Ga0099827_10125109	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	2076	Open in IMG/M
3300009090\|Ga0099827_10329323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1296	Open in IMG/M
3300009090\|Ga0099827_10801571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	815	Open in IMG/M
3300009792\|Ga0126374_10255597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1147	Open in IMG/M
3300009792\|Ga0126374_11433342	Not Available	564	Open in IMG/M
3300009813\|Ga0105057_1072106	Not Available	601	Open in IMG/M
3300010046\|Ga0126384_10480213	Not Available	1067	Open in IMG/M
3300010046\|Ga0126384_11974034	Not Available	557	Open in IMG/M
3300010047\|Ga0126382_10133116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1673	Open in IMG/M
3300010320\|Ga0134109_10495483	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	504	Open in IMG/M
3300010339\|Ga0074046_10119838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1690	Open in IMG/M
3300010339\|Ga0074046_10403518	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	825	Open in IMG/M
3300010358\|Ga0126370_10072516	All Organisms → cellular organisms → Bacteria	2282	Open in IMG/M
3300010359\|Ga0126376_13057379	Not Available	517	Open in IMG/M
3300010360\|Ga0126372_11172796	Not Available	791	Open in IMG/M
3300010360\|Ga0126372_12773834	Not Available	542	Open in IMG/M
3300010361\|Ga0126378_12143285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	638	Open in IMG/M
3300010362\|Ga0126377_10444689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	1317	Open in IMG/M
3300010376\|Ga0126381_100660120	Not Available	1493	Open in IMG/M
3300011271\|Ga0137393_10575832	Not Available	966	Open in IMG/M
3300012188\|Ga0136618_10432294	Not Available	568	Open in IMG/M
3300012189\|Ga0137388_10261932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1577	Open in IMG/M
3300012201\|Ga0137365_10151821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	1739	Open in IMG/M
3300012203\|Ga0137399_11005064	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	702	Open in IMG/M
3300012204\|Ga0137374_10061708	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.	3757	Open in IMG/M
3300012204\|Ga0137374_10760265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	722	Open in IMG/M
3300012212\|Ga0150985_106912161	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae	1475	Open in IMG/M
3300012349\|Ga0137387_11069869	Not Available	576	Open in IMG/M
3300012685\|Ga0137397_10002631	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	12445	Open in IMG/M
3300012918\|Ga0137396_10731619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	729	Open in IMG/M
3300012929\|Ga0137404_10382865	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1237	Open in IMG/M
3300012930\|Ga0137407_10790237	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	896	Open in IMG/M
3300012930\|Ga0137407_12205764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	526	Open in IMG/M
3300012960\|Ga0164301_11353137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	580	Open in IMG/M
3300012986\|Ga0164304_10476406	Not Available	906	Open in IMG/M
3300012987\|Ga0164307_11255806	Not Available	617	Open in IMG/M
3300012988\|Ga0164306_11178293	Not Available	641	Open in IMG/M
3300013066\|Ga0164281_102222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	554	Open in IMG/M
3300013075\|Ga0164288_1082033	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	898	Open in IMG/M
3300014655\|Ga0181516_10517550	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	613	Open in IMG/M
3300014658\|Ga0181519_10054632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2652	Open in IMG/M
3300014863\|Ga0180060_1033240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	670	Open in IMG/M
3300015248\|Ga0180079_1076177	Not Available	521	Open in IMG/M
3300015264\|Ga0137403_10933471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	717	Open in IMG/M
3300015374\|Ga0132255_104576586	Not Available	586	Open in IMG/M
3300016319\|Ga0182033_10954090	Not Available	761	Open in IMG/M
3300017787\|Ga0183260_10181471	Not Available	1485	Open in IMG/M
3300017789\|Ga0136617_10651471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	822	Open in IMG/M
3300017947\|Ga0187785_10690385	Not Available	535	Open in IMG/M
3300017959\|Ga0187779_10103194	All Organisms → cellular organisms → Bacteria → Proteobacteria	1720	Open in IMG/M
3300018028\|Ga0184608_10005799	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4002	Open in IMG/M
3300018071\|Ga0184618_10183409	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	869	Open in IMG/M
3300018072\|Ga0184635_10002225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	5847	Open in IMG/M
3300018072\|Ga0184635_10256682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	691	Open in IMG/M
3300018078\|Ga0184612_10395843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	694	Open in IMG/M
3300018432\|Ga0190275_10324471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1520	Open in IMG/M
3300018469\|Ga0190270_11223051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	790	Open in IMG/M
3300019361\|Ga0173482_10758423	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	509	Open in IMG/M
3300019377\|Ga0190264_11063740	Not Available	655	Open in IMG/M
3300019869\|Ga0193705_1066329	Not Available	720	Open in IMG/M
3300021090\|Ga0210377_10398153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	818	Open in IMG/M
3300021170\|Ga0210400_11288085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	586	Open in IMG/M
3300021178\|Ga0210408_10609719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	864	Open in IMG/M
3300021560\|Ga0126371_11019210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	969	Open in IMG/M
3300022756\|Ga0222622_10242990	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1216	Open in IMG/M
3300025912\|Ga0207707_10286420	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1426	Open in IMG/M
3300025922\|Ga0207646_10707894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	900	Open in IMG/M
3300025928\|Ga0207700_10874867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	804	Open in IMG/M
3300025928\|Ga0207700_11458104	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	608	Open in IMG/M
3300025941\|Ga0207711_10277430	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1543	Open in IMG/M
3300025945\|Ga0207679_10526098	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1058	Open in IMG/M
3300026530\|Ga0209807_1012966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4104	Open in IMG/M
3300027512\|Ga0209179_1064625	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	797	Open in IMG/M
3300027546\|Ga0208984_1025126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1223	Open in IMG/M
3300027587\|Ga0209220_1149620	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	604	Open in IMG/M
3300027616\|Ga0209106_1018733	All Organisms → cellular organisms → Bacteria → Proteobacteria	1497	Open in IMG/M
3300027862\|Ga0209701_10204101	Not Available	1177	Open in IMG/M
3300027875\|Ga0209283_10581571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	712	Open in IMG/M
3300027875\|Ga0209283_10614879	All Organisms → cellular organisms → Bacteria → Proteobacteria	687	Open in IMG/M
3300027880\|Ga0209481_10041752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	2106	Open in IMG/M
3300028712\|Ga0307285_10134391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	670	Open in IMG/M
3300028720\|Ga0307317_10029681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1703	Open in IMG/M
3300028791\|Ga0307290_10300216	Not Available	588	Open in IMG/M
3300028793\|Ga0307299_10054070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1479	Open in IMG/M
3300028803\|Ga0307281_10423403	Not Available	512	Open in IMG/M
3300028875\|Ga0307289_10034599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae	1998	Open in IMG/M
3300031152\|Ga0307501_10088829	Not Available	763	Open in IMG/M
3300031366\|Ga0307506_10344297	Not Available	596	Open in IMG/M
3300031545\|Ga0318541_10108380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1498	Open in IMG/M
3300031682\|Ga0318560_10247543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	957	Open in IMG/M
3300031720\|Ga0307469_10974681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	790	Open in IMG/M
3300031723\|Ga0318493_10085855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1558	Open in IMG/M
3300031747\|Ga0318502_10965763	Not Available	519	Open in IMG/M
3300031764\|Ga0318535_10065104	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1550	Open in IMG/M
3300031769\|Ga0318526_10137840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	989	Open in IMG/M
3300031831\|Ga0318564_10159073	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1008	Open in IMG/M
3300031833\|Ga0310917_10009723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5213	Open in IMG/M
3300031879\|Ga0306919_11092812	Not Available	608	Open in IMG/M
3300031890\|Ga0306925_10780374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	993	Open in IMG/M
3300031912\|Ga0306921_10802164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1075	Open in IMG/M
3300031942\|Ga0310916_10732744	Not Available	835	Open in IMG/M
3300031959\|Ga0318530_10325916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	635	Open in IMG/M
3300032076\|Ga0306924_10474380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1428	Open in IMG/M
3300032090\|Ga0318518_10124604	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1299	Open in IMG/M
3300032516\|Ga0315273_11015088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1061	Open in IMG/M
3300033289\|Ga0310914_11059862	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	711	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	88.16%
Host-Associated	Host-Associated	11.84%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	76.32%
Aquatic	Environmental → Aquatic	11.84%
Plants	Host-Associated → Plants	11.84%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	76.32%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.58%
Sediment	Environmental → Aquatic → Sediment	5.92%
Freshwater	Environmental → Aquatic → Freshwater	5.26%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.61%
Marine	Environmental → Aquatic → Marine	0.66%
Roots	Host-Associated → Plants → Roots	0.66%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	59.21%
Loam	Environmental → Terrestrial → Soil → Loam	13.82%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.61%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.29%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.63%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.97%
Ice	Environmental → Aquatic → Freshwater → Ice	1.97%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.32%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.66%
Lake	Environmental → Aquatic → Freshwater → Lake	0.66%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.66%
Sand	Environmental → Terrestrial → Soil → Sand	0.66%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.66%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	36.18%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	13.16%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.24%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.92%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.92%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.61%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.29%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.63%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.97%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.97%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.97%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.32%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.32%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.66%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.66%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.66%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.66%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.66%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.66%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	14.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	12.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	9.21%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.26%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	4.61%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.95%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.95%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.29%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.29%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.63%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.63%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	1.97%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.97%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.97%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.32%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.32%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.32%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.32%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	1.32%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.32%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.66%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.66%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.66%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.66%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.66%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.66%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.66%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.66%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.66%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.66%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.66%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.66%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.66%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.66%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.66%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.66%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004781	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh	Environmental	Open in IMG/M
3300005205	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009813	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012188	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013066	Enriched backyard soil microbial communities from Emeryville, California, USA - RNA 5th pass 37_C Kraft BY (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013075	Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 5th pass 30_C Kraft OP (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300014655	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG	Environmental	Open in IMG/M
3300014658	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG	Environmental	Open in IMG/M
3300014863	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10D	Environmental	Open in IMG/M
3300015248	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10D	Environmental	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300017787	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)	Environmental	Open in IMG/M
3300017789	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300019869	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2	Environmental	Open in IMG/M
3300021090	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental	Open in IMG/M
3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)	Environmental	Open in IMG/M
3300027546	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027587	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027616	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300028712	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139	Environmental	Open in IMG/M
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental	Open in IMG/M
3300028791	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144	Environmental	Open in IMG/M
3300028793	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300028875	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031723	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23	Environmental	Open in IMG/M
3300031747	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22	Environmental	Open in IMG/M
3300031764	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27	Environmental	Open in IMG/M
3300031769	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24	Environmental	Open in IMG/M
3300031831	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031959	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032090	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.61
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.61
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F045895

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1015580702	3300000364	Soil	VGMVRAVVEEAATLASLALFLGMVAIWAQVIATL*
F14TC_1108451032	3300000559	Soil	MFRALIEEAAALASLALFLGMIAIWAQIIATLGQVPQAWG*
JGI10216J12902_1015489812	3300000956	Soil	LCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL*
JGI12053J15887_100052462	3300001661	Forest Soil	MIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTSVM*
C688J35102_1183255311	3300002568	Soil	FLLCRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL*
C688J35102_1209778833	3300002568	Soil	LWDLAESIMIRAVVEEATTLTALALFIGMVAIWAQVIVTL*
Ga0062589_1003354621	3300004156	Soil	MFRFRSQESPMFRAVVEEAAALTSIALFLGMIAIWAQVLATL*
Ga0062589_1007713252	3300004156	Soil	MFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPQAWG*
Ga0063356_1005266121	3300004463	Arabidopsis Thaliana Rhizosphere	MFLFRSQESPMFRAVVEEAAALTSIALFLGMIAIWAQVLATL*
Ga0062592_1017511992	3300004480	Soil	MFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPEAWG*
Ga0062592_1024327472	3300004480	Soil	FRSQESPMFRAVVEEAAALTSIALFLGMIAIWAQVLATL*
Ga0062379_100500442	3300004781	Wetland Sediment	MEVAMLRSVVEEAAALASLALFLGMIAIWAQVIATLTILN
Ga0068999_100359122	3300005205	Natural And Restored Wetlands	FRSLWEGHMFRAVVEEAAALASLALFLGMIAIWAQVIATL*
Ga0066388_1010990622	3300005332	Tropical Forest Soil	MFLLCSRREAMIRAAVTEAAALASLALFLGMIAIWAQVIATL*
Ga0070669_1016541081	3300005353	Switchgrass Rhizosphere	GREDMFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPEAWG*
Ga0070671_1017411662	3300005355	Switchgrass Rhizosphere	MFCCVGVGIMVRAVVEEAAALASLTLFISMIAVWAQVLTAL*
Ga0066695_100018731	3300005553	Soil	WELVSMVRAVVEEAATLASLALFLGMVAIWAHVIATL*
Ga0066661_103969811	3300005554	Soil	VSMVRAVVEEAATLASLALFLGMVAIWAHVIATL*
Ga0066692_101159772	3300005555	Soil	LSSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL*
Ga0066670_110025182	3300005560	Soil	LSGVCVMVRAVVEEAATLASLALFLGMVAIWAQVIATL*
Ga0066705_100083374	3300005569	Soil	NGENDVMVRAVVEEAAALASLALFIGMIAIWAQVVAVQ*
Ga0066905_1001144242	3300005713	Tropical Forest Soil	MIRAVVEEAAALASLTLFLGMIAIWAQVISSFLTTPTL*
Ga0066903_1001048904	3300005764	Tropical Forest Soil	MIRAVVEEAAALASLALFLATIAIWAQVIGSVFATTTL*
Ga0066903_1006754263	3300005764	Tropical Forest Soil	MVRAVVEEAAALASLALFLATIAVWAQVIGAFFATSTS*
Ga0066903_1017373642	3300005764	Tropical Forest Soil	GGVGVMVRAVVEEAATLASLALFLGMVAIWAQVIASL*
Ga0066903_1033172651	3300005764	Tropical Forest Soil	AIPMIRALVEEAAAITSIALFVAMIAVWAHVFAVL*
Ga0066903_1085838061	3300005764	Tropical Forest Soil	RAVVEEAAALASLALFLGMIAIWAQVISSFLTTPTL*
Ga0068863_1006278472	3300005841	Switchgrass Rhizosphere	MEEAMLRSVFEEAAALASLALFLGMIAIWAQVFATL*
Ga0081540_12710382	3300005983	Tabebuia Heterophylla Rhizosphere	MSNMGRAIVEEIATLASLALFVGMVAIWAQVIATL*
Ga0081539_101454652	3300005985	Tabebuia Heterophylla Rhizosphere	MIRAVVEEAATLASLALFVGMIAIWAQVIAALLTTSVM*
Ga0081539_103471682	3300005985	Tabebuia Heterophylla Rhizosphere	MFGSLVMLRAVVEEAAALASLALFLGMLVIWAQVIATL*
Ga0070717_104526843	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIRAVVEEAATLASLALFLGMIAIWAQVIGALMATPTL*
Ga0075365_106973801	3300006038	Populus Endosphere	MSSMFRAVVEEAAALASLAMFLGMIAIWSQVIATF*
Ga0075023_1001008621	3300006041	Watersheds	FHESRGVEMFRTIVEEAAALASLALFLGMVAIWAQVIATL*
Ga0070712_1018659251	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MVRAVVEEAATLASLALFIGMIAIWAQVIGALMATPTL*
Ga0070712_1019392691	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MEETMLRSVFEEAAALASLALFLGMIAIWAQVFATL*
Ga0079222_109926291	3300006755	Agricultural Soil	SSGVGVMVRAVVEDAATLASLALFLGMVAIWARVIATL*
Ga0079220_114853262	3300006806	Agricultural Soil	SIGGSRCVMVRAVVEDAATLASLALFLGMVAIWAQVIATL*
Ga0075421_1000128097	3300006845	Populus Rhizosphere	MFRALIEEAAALASLALFLGMIAIWAQIIATLGNVPQAWG*
Ga0075420_1015502712	3300006853	Populus Rhizosphere	SFREGIMLRAVVEEAAAITSIALFLGMVAIWAQVIAAM*
Ga0075425_1003393682	3300006854	Populus Rhizosphere	MIRAVVEEAATLASLALFIGMIAIWAQVIGALMATPTL*
Ga0075434_1020459572	3300006871	Populus Rhizosphere	RGHMMRTVMEEAARLASLALFLGMVAVWAQVIAAL*
Ga0075424_1003785932	3300006904	Populus Rhizosphere	WGEAHMFRAMIEEAAALASLALFLGMIAIWAQVISTL*
Ga0066710_1007150392	3300009012	Grasslands Soil	MFRSLIEKAAAWASLALFLGMIAIWAQIVTTLGHVPEAWG
Ga0099830_117697081	3300009088	Vadose Zone Soil	SSSGRKDMVRAVVAEAAALASLALFLGMIAIWAQVIATL*
Ga0099828_108248412	3300009089	Vadose Zone Soil	MFRALIEEAAALASLALFLGMIAIWAQLIATLGQVPQAWG*
Ga0099827_101251092	3300009090	Vadose Zone Soil	GEWEIMVRALVEEAATLASLALFLGMIAIWVQVIATL*
Ga0099827_103293231	3300009090	Vadose Zone Soil	MEEAMLRSVFEEAAALASLALFLGMIAIWAQVIATL*
Ga0099827_108015712	3300009090	Vadose Zone Soil	MEKDMFRAVVEEAATLASLALFLGMIAIWAQVIATL*
Ga0126374_102555972	3300009792	Tropical Forest Soil	EWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL*
Ga0126374_114333422	3300009792	Tropical Forest Soil	LFLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL*
Ga0105057_10721062	3300009813	Groundwater Sand	MFQSVVEEAAAIASLALFLGMIAIWARIIATLGQVPEAWG*
Ga0126384_104802132	3300010046	Tropical Forest Soil	MEEAMLRSVFEEAAALASLALFLGMIAIWAQVFSTL*
Ga0126384_119740341	3300010046	Tropical Forest Soil	MGKVVNMIRAVVEEAATLASLALFLGMIPIWAQVIGALWSVPTL*
Ga0126382_101331162	3300010047	Tropical Forest Soil	MSMVRAVVEEAASLASLALFLGMVAIWAQVIATL*
Ga0134109_104954832	3300010320	Grasslands Soil	CVMVRAVVEEAATLASLALFLGMVAIWAQVIATL*
Ga0074046_101198382	3300010339	Bog Forest Soil	MLRAVVEEAAILASLALFIGMIAVWAEVIATFWA*
Ga0074046_104035182	3300010339	Bog Forest Soil	MLRAVVEEAAILASLALFIAMIAVWAQVIVTLWA*
Ga0126370_100725161	3300010358	Tropical Forest Soil	EVMVRAVVEEAVTLASLTLFLGMIAIWAKVIAAL*
Ga0126376_130573791	3300010359	Tropical Forest Soil	LEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL*
Ga0126372_111727961	3300010360	Tropical Forest Soil	AGREAMVRAVVEEAATLASLALFVGMIAIWAQVIATL*
Ga0126372_127738342	3300010360	Tropical Forest Soil	DRGGEIMIRAVVEEAATLASLALFLGMIAVWAHVIAVL*
Ga0126378_121432851	3300010361	Tropical Forest Soil	VEIMVRALVEEAATLASLALFLGMIAIWAQVIATL
Ga0126377_104446891	3300010362	Tropical Forest Soil	RSLEVAMLRSVFEEAAALASLALFLGMIAIWAQVIATL*
Ga0126381_1006601202	3300010376	Tropical Forest Soil	MIRAVVEEAAALASLALFLGMIAIWAQVISSFLTTPTL*
Ga0137393_105758322	3300011271	Vadose Zone Soil	MFRALIEEAAALASLALFLGMIAIWAQIVATLGNVPEAWG*
Ga0136618_104322942	3300012188	Polar Desert Sand	MFRMIIGEAAALTSLALFLGMIAVWAQVIATMTTTG*
Ga0137388_102619322	3300012189	Vadose Zone Soil	MFRALIEEAAALASLALFLGMIAIWAQLVATLGHVPEAWG*
Ga0137365_101518212	3300012201	Vadose Zone Soil	VGVVTMVRALVEEAATLASLALFLGMIAIWAHVIATL*
Ga0137399_110050642	3300012203	Vadose Zone Soil	MEDAMLRSVFEEAAALASLALFLGMIAIWAQVFATL*
Ga0137374_100617082	3300012204	Vadose Zone Soil	MFRALVEEAAALASLALFLGMIAIWAQIIAALGQVPEAWG*
Ga0137374_107602652	3300012204	Vadose Zone Soil	MFRALIEEAAALASLALFLGMIAIWAQIVATLGHMPEAWG*
Ga0150985_1069121612	3300012212	Avena Fatua Rhizosphere	WDLAESIMIRAVVEEATTLTALALFIGMVAIWAQVIVTL*
Ga0137387_110698691	3300012349	Vadose Zone Soil	MLRSVFEEAAALASLALFLGMIAIWAQVIAALLTTSVM*
Ga0137397_100026312	3300012685	Vadose Zone Soil	MEEAMLRSVFEEAAALASLALFLGMIAIWAQVLATL*
Ga0137396_107316191	3300012918	Vadose Zone Soil	MEDAMLRSVFEEAAALASLALFLGMIAIWAQVIATL*
Ga0137404_103828652	3300012929	Vadose Zone Soil	MEVAMLRSVFEEAAALASLALFLGMIAIWAQVFATL*
Ga0137407_107902372	3300012930	Vadose Zone Soil	GVMIRAIVEEAAALASVALFIGMIAIWAQVIATL*
Ga0137407_122057641	3300012930	Vadose Zone Soil	MEEAMLRSVFEEAAALASLALFLGMIAIWAQVFVTL*
Ga0164301_113531372	3300012960	Soil	VSDMGRAVVEEVATLTSLALFVGMVAIWAQVIATL*
Ga0164304_104764062	3300012986	Soil	MCRTIVEELATLASLALFLSMVAIWAQVIGIWVT*
Ga0164307_112558062	3300012987	Soil	MEEAMLRSVFEEAAALSSLALFLGMIAIWAQVFATL*
Ga0164306_111782932	3300012988	Soil	MGRTIVEELATLASLALFLSMVAIWAQVIGIWVT*
Ga0164281_1022222	3300013066	Soil	ADMFRAVMEEAAALASLAMFLGMIAVWAQVIAAL*
Ga0164288_10820331	3300013075	Soil	EVMIRAFLEEAAALASVTLFIGMIAIWAQVFSTF*
Ga0181516_105175501	3300014655	Bog	ENAGRANMIRAVVEEAAALASITLFVGMIVVWAQVFSVL*
Ga0181519_100546325	3300014658	Bog	MFENAGRANMIRAVVEEAAALASITLFVGMIVVWAQVFSVL*
Ga0180060_10332402	3300014863	Soil	MESIMFRAVIEEAAALTSITLFLGMIAIWAQVIAAM*
Ga0180079_10761772	3300015248	Soil	MESIMFRAVVEEAAALTSITLFLGMIAIWAQVIAAM*
Ga0137403_109334712	3300015264	Vadose Zone Soil	VRMFRAVAEEAAALTSLALFIGMIAIWAQVLTQL*
Ga0132255_1045765862	3300015374	Arabidopsis Rhizosphere	MGHTIVEELATLVSLALFLSMVAIWAQVIGIWVT*
Ga0182033_109540902	3300016319	Soil	AKLHMLRRIAEEAAALTSLALFLGMIAIWAQVIAAL
Ga0183260_101814713	3300017787	Polar Desert Sand	MFRAIVEEAAALASLALFLGMIAVWAQVIATMTTG
Ga0136617_106514712	3300017789	Polar Desert Sand	MVRTMVEEAAALASLALFLGMIAVWAQVIATMATG
Ga0187785_106903851	3300017947	Tropical Peatland	MIRAVVEEAATLASLALFLGMIAIWAQVIGALWAVPTL
Ga0187779_101031941	3300017959	Tropical Peatland	MFSVRSEEDPMFRAVVEEAAALASLALFLGMFAIWANVIATL
Ga0184608_100057993	3300018028	Groundwater Sediment	MEEAMLRSVFEEAAALASLALFLGMIAIWAQVFATL
Ga0184618_101834092	3300018071	Groundwater Sediment	MFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPEAWG
Ga0184635_100022252	3300018072	Groundwater Sediment	MFRALIEEAAALASLALFLGMIAIWAQIIATLGQVPQAWG
Ga0184635_102566822	3300018072	Groundwater Sediment	MEVAMLRSVVEEAAALASLALFLGMIAIWAQVIATL
Ga0184612_103958432	3300018078	Groundwater Sediment	LVGEIVMFRALIEEAAALASLALFLGMIAIWAQIIATLGQVPQAWG
Ga0190275_103244713	3300018432	Soil	MESLVMVRAVVEEAAALASLALFFGMIAVWAQVISAL
Ga0190270_112230511	3300018469	Soil	MFRALIEEAAALASLTLFLGMIAIWAQILVTLGHVPEAWG
Ga0173482_107584231	3300019361	Soil	MFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPQAWG
Ga0190264_110637401	3300019377	Soil	MEEPMFRAVVEEAAALTSLALFVGMLAVWVQVFAAM
Ga0193705_10663291	3300019869	Soil	ELDMVRAVVEEAATLASLALFLGMIAIWAQVIATL
Ga0210377_103981531	3300021090	Groundwater Sediment	MESIMFRAVIEEAAALTSITLFLGMIAIWAQVIAAM
Ga0210400_112880851	3300021170	Soil	YGGLPMFRAVVEEAAALASLALFIGMIAIWVQVIAVL
Ga0210408_106097193	3300021178	Soil	VSNMGRAIVEEIATLASLALFVGMIAIWAQVIATL
Ga0126371_110192101	3300021560	Tropical Forest Soil	MIRAVVEEAAALASLALFLGMIAIWAQVISSFLTTPT
Ga0222622_102429902	3300022756	Groundwater Sediment	MEEAMLRSVFEEAAALASLALFLGMIAIWAQVIATL
Ga0207707_102864203	3300025912	Corn Rhizosphere	MKEKVMFRAFVEEAAALASLALFVGMVAIWAQVFSTI
Ga0207646_107078942	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	VPVEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL
Ga0207700_108748671	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	SNQRRVGMFRIFAEEAAALTSLALFLGMVAIWAQVIATL
Ga0207700_114581042	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	VGIMVRAVVEEAAALASLTLFISMIAVWAQVLTAL
Ga0207711_102774301	3300025941	Switchgrass Rhizosphere	FLLLRSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL
Ga0207679_105260981	3300025945	Corn Rhizosphere	GSWIMVRAVVEEAATLASLALFLGMIAIWAQVIATL
Ga0209807_10129661	3300026530	Soil	NGENDVMVRAVVEEAAALASLALFIGMIAIWAQVVAVQ
Ga0209179_10646252	3300027512	Vadose Zone Soil	TESGDKVMVRAIVEEAAALASLALFLGMIAIWAQVIATL
Ga0208984_10251261	3300027546	Forest Soil	VMIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTSVM
Ga0209220_11496202	3300027587	Forest Soil	RDSMVRAVVEEAAALASLALFVGMIAIWAQFIAAL
Ga0209106_10187331	3300027616	Forest Soil	MIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTSVM
Ga0209701_102041011	3300027862	Vadose Zone Soil	VQWEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL
Ga0209283_105815711	3300027875	Vadose Zone Soil	MFRALIEEAAALASLALFLGMIAIWAQLIATLGQVPQAWG
Ga0209283_106148791	3300027875	Vadose Zone Soil	MFRALIEEAAALASLALFLGMIAIWAQVIASLLTTPTL
Ga0209481_100417522	3300027880	Populus Rhizosphere	MFRALIEEAAALASLALFLGMIAIWAQIIATLGNVPQAWG
Ga0307285_101343912	3300028712	Soil	PVGKKVMIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTPTL
Ga0307317_100296813	3300028720	Soil	MIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTPTL
Ga0307290_103002161	3300028791	Soil	AVVEEAATLASLALFLGMIAIWAQVIAALLTTSVM
Ga0307299_100540702	3300028793	Soil	SCGELDMVRAVVEEAATLASLALFLGMIAIWAQVIATL
Ga0307281_104234032	3300028803	Soil	MFRALIEEAAALASLALFLGMIAIWAQIVATLGHVPQ
Ga0307289_100345991	3300028875	Soil	FSSVGKKVMIRAVVEEAATLASLALFLGMIAIWAQVIAALLTTPTL
Ga0307501_100888292	3300031152	Soil	DLVMVRAVAVEAAALTSLALFLGMIAIWAQVIATL
Ga0307506_103442971	3300031366	Soil	LLLGSCIMVRAVVEEAATLASLALFLGMIAIWAQVIATL
Ga0318541_101083803	3300031545	Soil	MVCAVVEETATLTSLALFLGMVAIWAQVIARFECAQR
Ga0318560_102475432	3300031682	Soil	GVVIMVRALVEEAAALASLALFLGMIAIWAQVIATL
Ga0307469_109746812	3300031720	Hardwood Forest Soil	MFPLCSREEAMLRSVFEEAAALASLALFLGMIAIWAQVFATL
Ga0318493_100858552	3300031723	Soil	LWSGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL
Ga0318502_109657631	3300031747	Soil	SLSVHIGREPMIRAVAEEAAALASIAMFVGMIAIWAQVIAAL
Ga0318535_100651042	3300031764	Soil	REWIMFRAFAEEAAALASLALFLGMIAIWAQVIAIL
Ga0318526_101378402	3300031769	Soil	LSLGGEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL
Ga0318564_101590732	3300031831	Soil	LEEEVSMFRGFIEEAAILASLALFIGTIAVWAQVIATL
Ga0310917_100097231	3300031833	Soil	GRESPMFRAVVEEAAVLASLALFIGMIAVWAQVIAFY
Ga0306919_110928122	3300031879	Soil	MIRAVVEEAAALASLTLFLGMIAIWAQVISSLLATPTL
Ga0306925_107803741	3300031890	Soil	PGRFRMLRAVVEEAVALASLALFVGIVAIWVQIIAAL
Ga0306921_108021642	3300031912	Soil	TPGRFRMLRAVVEEAVALASLALFVGIVAIWVQIIAAL
Ga0310916_107327441	3300031942	Soil	VEIMVRALVEEAATLASPALFLGMIAIWAQVIATL
Ga0318530_103259162	3300031959	Soil	GEWEIMVRALVEEAATLASLALFLGMIAIWAQVIATL
Ga0306924_104743801	3300032076	Soil	SVHIGREPMIRAVAEEAAALASIAMFVGMIAIWAQVIAAL
Ga0318518_101246041	3300032090	Soil	VGVVIMVRALVDEAATLASLALFLGMIAIWAQVIATL
Ga0315273_110150881	3300032516	Sediment	MEDVMFRAVVEEAAALASITLFLGMIAIWAQVIAAM
Ga0310914_110598621	3300033289	Soil	LSVLERCANVFRAIIEETAVLASLTLFLGMIAIWAQVIATL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign