NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F046392

Metagenome / Metatranscriptome Family F046392

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046392
Family Type Metagenome / Metatranscriptome
Number of Sequences 151
Average Sequence Length 49 residues
Representative Sequence MSHIRIDKQKAVKKWSPVLENMGVTGDRVEWMSEYAEFHSINENAYAN
Number of Associated Samples 139
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.35 %
% of genes from short scaffolds (< 2000 bps) 89.40 %
Associated GOLD sequencing projects 137
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified bacterial viruses (70.199 % of family members)
NCBI Taxonomy ID 12333
Taxonomy All Organisms → Viruses → unclassified bacterial viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(14.569 % of family members)
Environment Ontology (ENVO) Unclassified
(41.722 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(53.642 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.05%    β-sheet: 0.00%    Coil/Unstructured: 53.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF08206OB_RNB 1.99
PF00773RNB 1.32
PF16363GDP_Man_Dehyd 0.66
PF05050Methyltransf_21 0.66
PF00733Asn_synthase 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG0557Exoribonuclease RTranscription [K] 3.31
COG4776Exoribonuclease IITranscription [K] 3.31
COG1158Transcription termination factor RhoTranscription [K] 1.99
COG1278Cold shock protein, CspA familyTranscription [K] 1.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.13 %
UnclassifiedrootN/A19.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111009|2217370303All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage534Open in IMG/M
3300000239|SI36aug09_120mDRAFT_1087320Not Available519Open in IMG/M
3300000439|TBL_comb48_EPIDRAFT_1041899All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1748Open in IMG/M
3300001282|B570J14230_10155928All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage650Open in IMG/M
3300001347|JGI20156J14371_10117029All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage812Open in IMG/M
3300002835|B570J40625_100113155All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage3275Open in IMG/M
3300002835|B570J40625_100409391Not Available1314Open in IMG/M
3300002933|G310J44882_10117476All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage556Open in IMG/M
3300003412|JGI25912J50252_10121252Not Available616Open in IMG/M
3300003412|JGI25912J50252_10141109All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage557Open in IMG/M
3300003654|SLW08_111405All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage762Open in IMG/M
3300004684|Ga0065168_1051302Not Available648Open in IMG/M
3300004764|Ga0007754_1033625All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage811Open in IMG/M
3300004787|Ga0007755_1559031Not Available515Open in IMG/M
3300005583|Ga0049085_10278139All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage546Open in IMG/M
3300006383|Ga0075504_1348044All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage573Open in IMG/M
3300006571|Ga0075505_1394358All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage769Open in IMG/M
3300007546|Ga0102874_1181636Not Available648Open in IMG/M
3300007560|Ga0102913_1117267All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage862Open in IMG/M
3300007593|Ga0102918_1113181Not Available810Open in IMG/M
3300007624|Ga0102878_1159966All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage653Open in IMG/M
3300007630|Ga0102903_1143151All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage656Open in IMG/M
3300007634|Ga0102901_1113346Not Available773Open in IMG/M
3300007658|Ga0102898_1122729All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage605Open in IMG/M
3300007718|Ga0102852_1132928Not Available506Open in IMG/M
3300007862|Ga0105737_1129008Not Available650Open in IMG/M
3300008107|Ga0114340_1121709All Organisms → Viruses → Predicted Viral1009Open in IMG/M
3300008113|Ga0114346_1274257All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage605Open in IMG/M
3300008114|Ga0114347_1002523Not Available20085Open in IMG/M
3300008117|Ga0114351_1095830All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage2443Open in IMG/M
3300008119|Ga0114354_1230693All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage613Open in IMG/M
3300008120|Ga0114355_1169814All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage746Open in IMG/M
3300008448|Ga0114876_1215333All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage633Open in IMG/M
3300008470|Ga0115371_10072612All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage556Open in IMG/M
3300008470|Ga0115371_10600882All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage764Open in IMG/M
3300008961|Ga0102887_1049752Not Available1384Open in IMG/M
3300008964|Ga0102889_1232041Not Available535Open in IMG/M
3300008999|Ga0102816_1057558All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1161Open in IMG/M
3300009052|Ga0102886_1185038Not Available616Open in IMG/M
3300009152|Ga0114980_10563181All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage646Open in IMG/M
3300009159|Ga0114978_10392481All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage832Open in IMG/M
3300009161|Ga0114966_10673150All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage569Open in IMG/M
3300009184|Ga0114976_10007043All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage6982Open in IMG/M
3300009239|Ga0103858_10014136All Organisms → Viruses → Predicted Viral1716Open in IMG/M
3300009657|Ga0116179_1013568All Organisms → Viruses → Predicted Viral4500Open in IMG/M
3300009674|Ga0116173_1319294All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage688Open in IMG/M
3300009677|Ga0115104_11085413Not Available553Open in IMG/M
3300009689|Ga0116186_1176017All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage974Open in IMG/M
3300009714|Ga0116189_1099054All Organisms → Viruses → Predicted Viral1168Open in IMG/M
3300009719|Ga0123383_107760All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage715Open in IMG/M
3300010160|Ga0114967_10301463All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage823Open in IMG/M
3300010334|Ga0136644_10346828All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage851Open in IMG/M
3300010338|Ga0116245_10255736All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage935Open in IMG/M
3300010342|Ga0116252_10355552All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage854Open in IMG/M
3300010885|Ga0133913_10338395All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage3982Open in IMG/M
3300010885|Ga0133913_10485017All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage3259Open in IMG/M
3300010885|Ga0133913_11365894All Organisms → Viruses → Predicted Viral1805Open in IMG/M
3300010885|Ga0133913_12438783All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1277Open in IMG/M
3300011010|Ga0139557_1065163Not Available611Open in IMG/M
3300012663|Ga0157203_1031132All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage748Open in IMG/M
3300012718|Ga0157557_1028592All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1262Open in IMG/M
3300012774|Ga0138283_1261624All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage543Open in IMG/M
3300013004|Ga0164293_10551742All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage754Open in IMG/M
(restricted) 3300013126|Ga0172367_10297087All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage956Open in IMG/M
(restricted) 3300013128|Ga0172366_10099546All Organisms → Viruses → Predicted Viral1943Open in IMG/M
(restricted) 3300013129|Ga0172364_10773734Not Available592Open in IMG/M
3300014050|Ga0119952_1141700All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage521Open in IMG/M
3300017766|Ga0181343_1085172All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage904Open in IMG/M
3300017778|Ga0181349_1113551All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1003Open in IMG/M
3300018560|Ga0188845_104284All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage600Open in IMG/M
3300019207|Ga0180034_1155916All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage816Open in IMG/M
3300019267|Ga0182069_1366182All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage756Open in IMG/M
3300020048|Ga0207193_1499743All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage807Open in IMG/M
3300020162|Ga0211735_10812930All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage3486Open in IMG/M
3300020193|Ga0194131_10129704All Organisms → Viruses → Predicted Viral1289Open in IMG/M
3300020205|Ga0211731_11418612All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage502Open in IMG/M
3300020438|Ga0211576_10041810All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage2657Open in IMG/M
3300020519|Ga0208223_1014432All Organisms → Viruses → Predicted Viral1185Open in IMG/M
3300020527|Ga0208232_1028707Not Available764Open in IMG/M
3300020562|Ga0208597_1030989All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1127Open in IMG/M
3300020732|Ga0214201_1026303All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage993Open in IMG/M
3300021127|Ga0214193_1001658All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage4125Open in IMG/M
3300021420|Ga0210394_10670965All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage909Open in IMG/M
3300021963|Ga0222712_10414220Not Available816Open in IMG/M
3300022752|Ga0214917_10266204Not Available787Open in IMG/M
3300022857|Ga0222653_1039527All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage785Open in IMG/M
3300023179|Ga0214923_10331078All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage812Open in IMG/M
3300023179|Ga0214923_10475024All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage621Open in IMG/M
3300023184|Ga0214919_10061714Not Available3466Open in IMG/M
3300023184|Ga0214919_10228155All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1361Open in IMG/M
3300023184|Ga0214919_10286560All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1148Open in IMG/M
3300023235|Ga0222634_1022738All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1071Open in IMG/M
3300024346|Ga0244775_11161034All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage603Open in IMG/M
3300024485|Ga0256318_1083772All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage682Open in IMG/M
3300024552|Ga0256345_1066780All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage694Open in IMG/M
3300024566|Ga0256309_1030991All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1442Open in IMG/M
3300024850|Ga0255282_1048413All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage752Open in IMG/M
3300024865|Ga0256340_1065461All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage906Open in IMG/M
3300025587|Ga0208938_1117589All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage591Open in IMG/M
3300025603|Ga0208414_1037027All Organisms → Viruses → Predicted Viral1443Open in IMG/M
3300025613|Ga0208461_1106526All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage751Open in IMG/M
3300025737|Ga0208694_1007605Not Available8397Open in IMG/M
3300025821|Ga0209600_1067473All Organisms → Viruses → Predicted Viral1148Open in IMG/M
3300025822|Ga0209714_1089619All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage877Open in IMG/M
3300025869|Ga0209308_10172209All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage978Open in IMG/M
3300025894|Ga0209335_10414620All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage538Open in IMG/M
3300027193|Ga0208800_1052774All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage553Open in IMG/M
3300027198|Ga0208163_1041962All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage748Open in IMG/M
3300027233|Ga0208678_1074190Not Available674Open in IMG/M
3300027418|Ga0208022_1099567All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage600Open in IMG/M
3300027468|Ga0209247_1024791Not Available827Open in IMG/M
3300027659|Ga0208975_1065296All Organisms → Viruses → Predicted Viral1094Open in IMG/M
3300027707|Ga0209443_1089328All Organisms → Viruses → Predicted Viral1183Open in IMG/M
3300027710|Ga0209599_10187022All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage557Open in IMG/M
3300027732|Ga0209442_1288954Not Available570Open in IMG/M
3300027744|Ga0209355_1091615All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1389Open in IMG/M
3300027769|Ga0209770_10070444All Organisms → Viruses → Predicted Viral1464Open in IMG/M
3300027772|Ga0209768_10023654All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage3413Open in IMG/M
3300027785|Ga0209246_10212244All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage755Open in IMG/M
3300027808|Ga0209354_10284601All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage659Open in IMG/M
3300027816|Ga0209990_10102473All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1388Open in IMG/M
3300027902|Ga0209048_10928334All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage560Open in IMG/M
3300028095|Ga0247563_1096415Not Available534Open in IMG/M
3300028108|Ga0256305_1105272All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage680Open in IMG/M
3300028108|Ga0256305_1178384Not Available504Open in IMG/M
3300028178|Ga0265593_1095123All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage799Open in IMG/M
(restricted) 3300028581|Ga0247840_10324755All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage782Open in IMG/M
3300029922|Ga0311363_11124161All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage672Open in IMG/M
3300029957|Ga0265324_10163589All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage756Open in IMG/M
3300031613|Ga0307978_1031719All Organisms → Viruses → Predicted Viral2517Open in IMG/M
3300031669|Ga0307375_10624978All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage631Open in IMG/M
3300031758|Ga0315907_10922712All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage639Open in IMG/M
3300031784|Ga0315899_11474032All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage572Open in IMG/M
3300031787|Ga0315900_10476742All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage955Open in IMG/M
3300031857|Ga0315909_10944611All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage527Open in IMG/M
3300031857|Ga0315909_10999369All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage505Open in IMG/M
3300031963|Ga0315901_10121045All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage2383Open in IMG/M
3300031963|Ga0315901_10931230All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage615Open in IMG/M
3300032092|Ga0315905_10517306All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1096Open in IMG/M
3300033816|Ga0334980_0120419All Organisms → Viruses → Predicted Viral1085Open in IMG/M
3300033995|Ga0335003_0161244All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage1107Open in IMG/M
3300034018|Ga0334985_0506662All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage694Open in IMG/M
3300034064|Ga0335001_0662647All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage545Open in IMG/M
3300034082|Ga0335020_0265321All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage847Open in IMG/M
3300034095|Ga0335022_0589195Not Available564Open in IMG/M
3300034102|Ga0335029_0062551All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage2701Open in IMG/M
3300034107|Ga0335037_0696336Not Available530Open in IMG/M
3300034110|Ga0335055_0430031All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage540Open in IMG/M
3300034272|Ga0335049_0563831Not Available713Open in IMG/M
3300034355|Ga0335039_0487608All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage619Open in IMG/M
3300034357|Ga0335064_0858508All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage550Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater14.57%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine11.26%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake10.60%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.28%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater5.96%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge5.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.30%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater4.64%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.97%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water2.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.99%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.99%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.32%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.32%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.32%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.32%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.32%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.32%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment1.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.66%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.66%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.66%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.66%
Subglacial FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater0.66%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.66%
Saline Water Concentrator PondEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Saline Water Concentrator Pond0.66%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.66%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.66%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.66%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.66%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.66%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.66%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.66%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.66%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.66%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111009Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS19EnvironmentalOpen in IMG/M
3300000239Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 120mEnvironmentalOpen in IMG/M
3300000439Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001347Pelagic Microbial community sample from North Sea - COGITO 998_met_06EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300002933Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USAEnvironmentalOpen in IMG/M
3300003412Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DDEnvironmentalOpen in IMG/M
3300003654Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 0.8 micron filterEnvironmentalOpen in IMG/M
3300004684Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2)EnvironmentalOpen in IMG/M
3300004764Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004787Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007546Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02EnvironmentalOpen in IMG/M
3300007560Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007624Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009052Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009239Microbial communities of water from Amazon river, Brazil - RCM11EnvironmentalOpen in IMG/M
3300009657Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaGEngineeredOpen in IMG/M
3300009674Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaGEngineeredOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009689Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaGEngineeredOpen in IMG/M
3300009714Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaGEngineeredOpen in IMG/M
3300009719Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_260_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010338AD_JPMRcaEngineeredOpen in IMG/M
3300010342AD_JPNAca1EngineeredOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300012718Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES050 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012774Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300014050Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007BEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300018560Metatranscriptome of marine microbial communities from Baltic Sea - GS678_3p0EnvironmentalOpen in IMG/M
3300019207Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019267Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071402VT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020519Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020562Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020732Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnionEnvironmentalOpen in IMG/M
3300021127Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 epilimnionEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300022857Saline water microbial communities from Ace Lake, Antarctica - #419EnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300023235Saline water microbial communities from Ace Lake, Antarctica - #50EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024485Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024552Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024566Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024850Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024865Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025587Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025603Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE (SPAdes)EnvironmentalOpen in IMG/M
3300025613Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025737Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025821Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027198Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes)EnvironmentalOpen in IMG/M
3300027233Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027468Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027707Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027744Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028095Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 11R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028108Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028178Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36mEnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300031613Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1056EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034018Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034110Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
22173741632209111009Saline Water Concentrator PondMVEINLEKAKKKWTPLLENMGVNDNERHDWMSEYAEYHSVNENA
SI36aug09_120mDRAFT_108732023300000239MarineMSHIRIDKQKAMKKWSPVLENMGVAGEDRLDWMSEYAEF
TBL_comb48_EPIDRAFT_104189913300000439FreshwaterMNHIRIDEKKALNKWAPVLENMGIQDADRLQWMSEYAEYHAINENAYANVSNV
B570J14230_1015592823300001282FreshwaterMSQIRIDNQKAMKKWSPVLENMGVSGEKLEWMAEYAEFHSINENAYVNATNVAGMGAVLNPVLGG
JGI20156J14371_1011702923300001347Pelagic MarineMSHIRIDKQKAMKKWSPVLENMGVAGEDRLDWMSEYAEFHSINENAYANASN
B570J40625_10011315543300002835FreshwaterMSHIRIDKQKAVKKWAPVLENMGVTGDRVEWLAEYAEFHSINEN
B570J40625_10040939123300002835FreshwaterMSHIRIDKAKATKKWAPVLENMGVTGERVEWMAEYAEFHSINENAYVNASNVAGMGAV
G310J44882_1011747613300002933FreshwaterMSHIRIDNAKATKKWAPVLENMGVTGDRVEWMAEYAEFHSINENAYVN
JGI25912J50252_1012125213300003412Freshwater LakeMSHIRIDKSKALKKWSPVLENMGVSEDRLDWMSEMAEYHSINENAYVNASNVAGMGSVLNPV
JGI25912J50252_1014110913300003412Freshwater LakeMSHIRIDKSKAIKKWSPVLENMGVTGDRMEWMAEYAEFHSINENAYVNA
SLW08_11140523300003654Subglacial FreshwaterMSHIRIDKQKAMKKWSPVLENMGVIGEDRLEWMSEYAEFHSINENAYANASNVSGM
Ga0065168_105130223300004684FreshwaterMSHIRIDKQKAVKKWAPVLENMGVTGDRVEWLAEYAEFHSINENAYANATTAGMGSVVAP
Ga0007754_103362513300004764Freshwater LakeMSHIRIDKSKALKKWSPVLENMGVSEDRLDWMSEMAEYHSINENAYVNA
Ga0007755_155903123300004787Freshwater LakeMSHIRIDKSKALKKWSPVLENMGVSEERLDWMSEMAEYHSINENAYVN
Ga0049085_1027813923300005583Freshwater LenticMSHIRIDKAKATKKWAPVLENMGVTGDRVEWMAEYAEFHSINE
Ga0075504_134804423300006383AqueousMSYIRINKDKAVKKWTPVLENMGVTNEDRLDWLSEYAEYHTINENAYVNA
Ga0075505_139435813300006571AqueousMSHIRIDKQKAVKKWTPVLENMGVTGDRVEWMSELAEFHSINENAYANATTAG
Ga0102874_118163623300007546EstuarineMSHIRIDKSKALKKWSPVLENMGVSEERLDWMSEMAEYHSINENAYV
Ga0102913_111726723300007560EstuarineMSHIRIDKSKAVKKWAPVLENMGVTEDRVEWMSEMAEYHSIN
Ga0102918_111318113300007593EstuarineMSHIRIDKSKAVKKWAPVLENMGVTEDRVEWMSEMAEYHSINENAYVNASNVAG
Ga0102878_115996613300007624EstuarineMSHIRIDKSKALKKWSPVLENMGVSEERLDWMSEMAEYHSINENA
Ga0102903_114315113300007630EstuarineMSHIRIDKSKAVKKWAPVLENMGVAEDRVEWMSEMAEYHSIN
Ga0102901_111334623300007634EstuarineMSHIRIDKSKAVKKWAPVLENMGVAEDRVEWMSEMAEYHSINENAYVNAA
Ga0102898_112272923300007658EstuarineMSHIRIDKQKAMKKWSPVLENMGVAGEERLDWMSEYAEFHSINENAYANASNVS
Ga0102852_113292813300007718EstuarineMSHIRIDKQKAMKKWSPVLENMGVAGEDRLDWMSEYAEFH
Ga0105737_112900813300007862Estuary WaterMSHIRIDKQKAMKKWSPVLENVGVAGEDRLDSMSEYAEFHSINEHAYANASN
Ga0114340_112170913300008107Freshwater, PlanktonMSHIRIDKSKAVKKWSPVLENMGVAEDRVEWMSEMAEYHSINENAYVNAT
Ga0114346_127425723300008113Freshwater, PlanktonMSHIRIDNAKATKKWAPVLENMGVTGDRVEWMAEYAEFHSINENAY
Ga0114347_100252353300008114Freshwater, PlanktonMSHIRIDKSKALKKWSPVLENMGVAGEDRLDWMSEYAEYHSINENA*
Ga0114351_109583013300008117Freshwater, PlanktonMSHIRIDKQKAVKKWTPVLENMGVTGERIDWMAEYAEYHS
Ga0114354_123069313300008119Freshwater, PlanktonMSHIRIDKSKALKKWSPVLENMGVAGEDRLDWMSEYAEYH
Ga0114355_116981413300008120Freshwater, PlanktonMSHIRIDKQKAVKKWAPVLENMGVTGERVDWMAEYAEFHSINENAYANATTAGM
Ga0114876_121533323300008448Freshwater LakeMSHIRIDKQKALKKWAPVLENMGVAGEDRLDWMSEYAEFHSINENAYVNATLAGMG
Ga0115371_1007261213300008470SedimentMIQIDKSKALKKWTPILENMGVTAPERVDWMAEYAEFHSIHENAYANLGTSTVWVL*
Ga0115371_1060088223300008470SedimentMSQIRIDEQKAVKKWTPILENMGVASDKIGWMAEYAEFHSINENAYANAANVTGMGNVVAAQPS
Ga0102887_104975223300008961EstuarineMAQIRIDKKKAINKWSPVLENMGVAEERVEWMSEMAEFHSINENAYANANV
Ga0102889_123204123300008964EstuarineMAQIRIDKKKAINKWSPVLENMGVAEERVEWMSEMAEFHSINENAYA
Ga0102816_105755833300008999EstuarineMSHIRIDKSKALKKWSPVLENMGVSEERLDWMSEMAEYHSIN
Ga0102886_118503813300009052EstuarineMAQIRIDKKKAINKWSPVLENMGVAEERVEWMSEMAEFHSI
Ga0114980_1056318123300009152Freshwater LakeMSHIRIDKQKAVKKWSPVLENMGVTGDRVEWMSEYAEFHSIN
Ga0114978_1039248123300009159Freshwater LakeMSHIRIDKQKALKKWSPVLENMGVAGEDRLDWMSEYAEFH
Ga0114966_1067315023300009161Freshwater LakeMSNIRIDKIKAVKKWSPVLENMGVAGDRVEWMSEYAEFHSIN
Ga0114976_1000704313300009184Freshwater LakeMSHIRIDKQKAVKKWSPVLENMGVTGDRVEWMSEYAEFHSINENAYANATT
Ga0103858_1001413623300009239River WaterMSHIRIDKQKAVKKWAPVLENMGITGERVDWMAEYADFHQIN*
Ga0116179_101356813300009657Anaerobic Digestor SludgeMSHIRIDKQKAIKKWTPVLENMGVTGERTEWMAEYAEFHSINENAYVNASNVA
Ga0116173_131929413300009674Anaerobic Digestor SludgeMSQIRIDNQKAMKKWSPVLENMGVSGEKLEWMAEYAEFHSINENAYVNAANVAGMGAVLN
Ga0115104_1108541323300009677MarineMAQIRIDKKKAVNKWSPVLENMGVAGERVEWMSEMAEFHSINENAYAN
Ga0116186_117601713300009689Anaerobic Digestor SludgeMLRIDEQKAIKKWSPVLENMGIAKTDVDRLQWMSEYAEYHSINENAYVNA
Ga0116189_109905423300009714Anaerobic Digestor SludgeMSHIRIDKQKAIKKWTPVLENMGVTGERTEWMAEYAEFHSINENAYVNASNVAGMGSVVA
Ga0123383_10776013300009719MarineMSHIRIDKQKAVKKWAPVLENMGVAGERVDWMAEYAEFHSINENAYANASNVAGMGGV
Ga0114967_1030146323300010160Freshwater LakeMSHIRIDKQKAVKKWGPVLENMGVSVDKVEWMSEMAEYHSINENAYANATN
Ga0136644_1034682813300010334Freshwater LakeMSHIRIDKQKALKKWGPVLENMGVAGEDRLDWMSEYA
Ga0116245_1025573613300010338Anaerobic Digestor SludgeMSHIRIDKSKALKKWTPVLENMGIKDDTRLDWMSEY
Ga0116252_1035555223300010342Anaerobic Digestor SludgeMSHIRIDKQKAYKKWAPVLENMGVVSEEKLDWLSEYAEYHSINENA
Ga0133913_1033839513300010885Freshwater LakeMSHIRIDNAKATKKWAPVLENMGVSGDRVEWMAEYAEFHSINENAYVNA
Ga0133913_1048501713300010885Freshwater LakeMSHIRIDKQKAFKKWAPVLENMGVGGEDRLDWMSEYAEYHSINENAYVNATLAG
Ga0133913_1136589423300010885Freshwater LakeMSHIRIDKQKAVKKWTPVLENMGVSAERVEWMSEMAEYHSINENAYVNASNV
Ga0133913_1243878323300010885Freshwater LakeMSHIRIDKSKALKKWAPVLENMGVSGEDKLDWMSEYAEFHSINENAYVNATLAGMGAV
Ga0139557_106516323300011010FreshwaterMSHIRIDKSKALKKWSPVLENMGVSEDRLDWMSEMAEYH
Ga0157203_103113223300012663FreshwaterMSQIRIDNQKAMKKWSPVLENMGVSGDKLEWMAEYAEFHSINENAYVN
Ga0157557_102859223300012718FreshwaterMSHIRIDKSKALKKWAPVLENMGVSGEDKLDWMSEYAEFHSI
Ga0138283_126162423300012774Freshwater LakeMSHIRIDNQKAMKKWSPVLENMGVTGDRVEWMSEYAEFHSIN
Ga0164293_1055174213300013004FreshwaterMSHIRIDKNKAIKKWSPVLENMGVTSDRFEWMSEMAEYH
(restricted) Ga0172367_1029708713300013126FreshwaterMSHIRIDSQKALKKWSPVLENMGITDSDRLNWMSEYAEFHSINENAYVNAGIQGMG
(restricted) Ga0172366_1009954623300013128SedimentMSHIRIDKNKAMKKWSPVLENMGVSSDRFEWMSEMAEYHSINENAYANATVAGMGAVTAP
(restricted) Ga0172364_1077373413300013129SedimentMSHIRIDKSKATKKWAPVLENMGVTGEDRVEWMSEYA
Ga0119952_114170013300014050FreshwaterMSHIRIDKQKALKKWAPVLENMGVGGEERLDWMSEYAEYHSINENA
Ga0181343_108517223300017766Freshwater LakeMSHIRIDKSKAIKKWSPVLENMGVTGERVDWMAEYAEFHSINE
Ga0181349_111355113300017778Freshwater LakeMSHIRIDNQKAMKKWSPVLENMGVTGDRVEWMSEYAEFHSINENAYVNASNVAGMGS
Ga0188845_10428423300018560Freshwater LakeMSHIRIDKNKAVKKWGPVLENMGVTNEERVDWLSEYAEFHSINENAYV
Ga0180034_115591613300019207EstuarineMSHIRIDKSKAVKKWAPVLENMGVAEERVEWMSEMAEYHSINENAYVNASNVAG
Ga0182069_136618213300019267Salt MarshMLQIDKNKALAKWTPVLENMGVQGDDRMDWMSEYAEQHAMLENVAYANFANI
Ga0207193_149974313300020048Freshwater Lake SedimentMSHIRIDKQKAVKKWTPVLENMGVSAERVEWMSEMAEYHSINENAYVNASNVSGMGSVLA
Ga0211735_1081293043300020162FreshwaterMSHIRIDKSKAVKKWAPVLENMGVTEDRVEWMSEMA
Ga0194131_1012970423300020193Freshwater LakeMSHIRIDSQKALKKWSPVLENMGITDSDRLNWMSEYAEFHSINENAYVNAGILGMGA
Ga0211731_1141861213300020205FreshwaterMSHIRIDKQKAVKKWSPVLENMGVTGERAEWMAEYAEFHSINENAYVNASNV
Ga0211576_1004181013300020438MarineMAQIRIDKKKAVNKWSPVLENMGVAGERVEWMSEMAEFHSINENAYANAN
Ga0208223_101443223300020519FreshwaterMSHIRIDKQKAVKKWTPVLENMGVSAERVEWMSEMAEYHSINENAYVNASNVAGMGAVTA
Ga0208232_102870713300020527FreshwaterMSHIRIDKSKAVKKWAPVLENMGVTEDRVEWMSEMAEYHSINENAYV
Ga0208597_103098913300020562FreshwaterMSHIRIDKAKATKKWAPVLENMGVTGDRVEWMAEYA
Ga0214201_102630323300020732FreshwaterMSNIRIDKQKAYKKWAPVLENMGVQGEERLDWMSEYFSLNFNL
Ga0214193_100165813300021127FreshwaterMSHIRIDKNKAIKKWTPVLENMGVTGDRVEWMSEYAE
Ga0210394_1067096513300021420SoilMNIRVDKQKALGKWGKVLESMGVTDADRKDWMSEYAELHAINE
Ga0222712_1041422013300021963Estuarine WaterMSHIRIDNQKAMKKWAPVLENMGVSGERVEWMSEYAEFHSI
Ga0214917_1026620413300022752FreshwaterMSNIRIDKSKALKKWGPVLENMGVSSSDRLDWMSE
Ga0222653_103952713300022857Saline WaterMSHIRIDKNKAVKKWGPVLENMGVTNEERVDWLSEYAEFHSIN
Ga0214923_1033107823300023179FreshwaterMSHIRIDKQKALKKWSPVLENMGVTGEDRLDWMSE
Ga0214923_1047502423300023179FreshwaterMSNIRIDSQKALKKWSPVLENMGVTNEDRLNWMSEYAEYHTINENAYVNAANAGMGGVFSPMPS
Ga0214919_1006171413300023184FreshwaterMSHIRIDNQKAMKKWSPVLENMGVTGDRVEWMSEY
Ga0214919_1022815513300023184FreshwaterMSHIRIDKQKAVKKWGPVLENMGVSVDKVEWMSEMAEYHSINENAYANATTAGMGGVVSAIP
Ga0214919_1028656023300023184FreshwaterMSHIRIDKAKATKKWAPVLENMGVTGDRVEWMAEYAEFHSINENAYVNA
Ga0222634_102273823300023235Saline WaterMSHIRIDKQKAVKKWGPVLENMGVGEDRVDWMSEYAELHSINENAYVNATTAGM
Ga0244775_1116103413300024346EstuarineMSHIRIDKQKAVKKWSPVLENMGVTGDRVEWMSEYAEFHSINE
Ga0256318_108377223300024485FreshwaterMSHIRIDKQKAVKKWSPVLENMGVTGDRVEWMSEYAEFHSINENAYAN
Ga0256345_106678023300024552FreshwaterMSHIRIDKQKAVKKWSPVLENMGVSGDRVEWMSEYAEFHSINENAYANTAVAGMGAVLNP
Ga0256309_103099123300024566FreshwaterMSHIRIDKQKAVKKWSPVLENMGVTGDRVEWMSEYAEFHSINENAYSNTAIAGMG
Ga0255282_104841323300024850FreshwaterMSHIRIDKSKAVKKWSPVLENMGVANDRVEWMSEMAEYHSINENAYVNAANVAGMGSVTSPQ
Ga0256340_106546113300024865FreshwaterMSNIRIDKSKAVKKWAPVLENMGVSGERVEWMSEMAEY
Ga0208938_111758913300025587Anaerobic Digestor SludgeMSHIRIDNQKAMKKWAPVLENMGVSGERVEWMSEYAEFHSINENAYVNASNVAGLGSVVA
Ga0208414_103702723300025603Saline LakeMSHIRIDKNKAVKKWGPVLENMGVTNEERVDWLSEYAEFHSINENAYVNATTAGMG
Ga0208461_110652613300025613Anaerobic Digestor SludgeMSHIRIDKQKAVKKWTPVLENMGVTGDRIEWMSEMAEYQSLNENAYANATTAGMGAVLNPLVG
Ga0208694_1007605123300025737Anaerobic Digestor SludgeMSQIRIDNQKAMKKWSPVLENMGVSGDRLEWMSEYAEFHSINENAY
Ga0209600_106747323300025821Pelagic MarineMSHIRIDKQKAMKKWSPVLENMGVAGEDRLDWMSE
Ga0209714_108961913300025822Pelagic MarineMSHIRIDKQKAMKKWSPVLENMGVAGEDRLDWMSEYAEFHSINENAYANASNVSGMGAVIAAQPN
Ga0209308_1017220923300025869Pelagic MarineMSHIRIDKQKAMKKWSPVLENMGVAGEDRLDWMSEYAEFHSINENAYANASNVSGMGAVIAA
Ga0209335_1041462013300025894Pelagic MarineMSHIRIDKQKAMKKWSPVLENMGVAGEDRLDWMSEYAEFHSI
Ga0208800_105277413300027193EstuarineMSHIRIDKAKATKKWAPVLENMGVTGDRVEWMAEYAEFHSINENAYVN
Ga0208163_104196213300027198EstuarineMSHIRIDKQKAVKKWSPVLENMGVAGDRVEWMSEYAEFHSIN
Ga0208678_107419013300027233EstuarineMAQIRIDKKKAINKWSPVLENMGVAEERVEWMSEMAEFHSINENAYANANVAG
Ga0208022_109956713300027418EstuarineMSHIRIDKQKATKKWSPVLENMGVSGERLDWMSEYAEFHSINENAY
Ga0209247_102479113300027468Freshwater LakeMSHIRIDKSKALKKWSPVLENMGVSEDRLDWMSEMAEYHSINENAYVNASNV
Ga0208975_106529613300027659Freshwater LenticMSHIRIDKSKALKKWSPVLENMGVSEDRLDWMSEMAEYHSINEN
Ga0209443_108932823300027707Freshwater LakeMSHIRIDKSKALKKWSPVLENMGVSEDRLDWMSEMAEYHSINENAYVNATNVAGMG
Ga0209599_1018702213300027710Deep SubsurfaceMSHIRIDNQKAMKKWSPVLENMGVTGDRVEWMSEYAEFHSINENAYVNGSNVAGM
Ga0209442_128895413300027732Freshwater LakeMSHIRIDKSKALKKWSPVLENMGVSEDRLDWMSEMAEYHSINENAYVNASNVAGMGSVLNPVV
Ga0209355_109161523300027744Freshwater LakeMSHIRIDKQKAVKKWAPVLENMGVTGERAEWMAEYAEFHSINENAYVNASNVA
Ga0209770_1007044423300027769Freshwater LakeMSHIRIDKSKAVKKWAPVLENMGVAEDRVEWMSEMAEYHSINE
Ga0209768_1002365443300027772Freshwater LakeMSHIRIDKSKALKKWSPVLENMGVSEDRLDWMSEMAEYHSINENAYVNASNVAGMGSVL
Ga0209246_1021224423300027785Freshwater LakeMSHIRIDKSKAIKKWSPVLENMGVTGERVEWMAEYAEFHSINENAYVNASNVSGMGAV
Ga0209354_1028460113300027808Freshwater LakeMSHIRIDKAKATKKWAPVLENMGVTGDRVEWMAEYAEFHSINENGYVNA
Ga0209990_1010247313300027816Freshwater LakeMSNIRIDKQKALKKWSPVLENMGITNEDRLDWMSEYAEFHTINENAYVNAANAGMG
Ga0209048_1092833413300027902Freshwater Lake SedimentMSHIRIDKQKAIKKWTPVLENMGVVDAERIDWMAEYAEFHSINENAYVNQNNLAGLGN
Ga0247563_109641523300028095SeawaterMSHIRIDNAKATKKWAPVLENMGVTGDRVEWMSEY
Ga0256305_110527223300028108FreshwaterMSHIRIDKQKAVKKWSPVLENMGVTGDRVEWMSEYAEFHSINENAYANTAIA
Ga0256305_117838423300028108FreshwaterMSHIRIDKSKAVKKWAPVLENMGVAEDRVEWMSEMAEYHSINENAYVNATNVAGM
Ga0265593_109512313300028178Saline WaterMSHIRIDKSKALKKWSPVLENMGVSEDRLDWMSEMAEYHSINENAYVNAANVA
(restricted) Ga0247840_1032475523300028581FreshwaterMSHIRIDKSKAIKKWSPVLENMGVEGDRVEWMAEYAEFHSINENAYANATTAGMGAVTAP
Ga0311363_1112416113300029922FenMNIRVDKQKAIGKWGKVLESMGVTDADRIDWMSEYAELHAINENAYANASNVAGMGNVVSAQ
Ga0265324_1016358913300029957RhizosphereMSHIRIDKQKAVKKWAPVLENMGVTGDRIDWMAEYAEFHQINENAYVNASNVAGM
Ga0307978_103171923300031613Saline WaterMSHIRIDNQKAKKKWTPVLENMGVSGDRIDWMSEYAEFHSINENA
Ga0307375_1062497813300031669SoilMSNIKIDKNKALKKWTPVLENMGVNTEDRLDWMSEYAEQH
Ga0315907_1092271223300031758FreshwaterMSNFRIDKQKAVKKWSPVLENMGVTGDRVEWMSEYAEFHSINENAYANAT
Ga0315899_1147403223300031784FreshwaterMSHIRIDKQKAVKKWSPVLENMGVTGDRVEWMSEYAEFHSINEN
Ga0315900_1047674223300031787FreshwaterMSHIRIDKQKAVKKWAPVLENMGVTGERVDWMSEYAEFHSINENAYVNASNV
Ga0315909_1094461123300031857FreshwaterMSHIRIDKSKAIKKWSPVLENMGVTGDRMEWMAEYAEFHSINENAYVN
Ga0315909_1099936923300031857FreshwaterMSHIRIDKQKAVKKWSPVLENMGVSGDRVEWMSEYAEFHSINENAYANATTAGMGQVIA
Ga0315901_1012104523300031963FreshwaterMSHIRIDKAKATKKWAPVLENMGVTGDRVEWMAEYAEFHSINENAYVNASNVAGMG
Ga0315901_1093123023300031963FreshwaterMSHIRIDKQKAVKKWSPVLENMGVTGDRVEWMSEYAEFHSINENAYANTAIAG
Ga0315905_1051730623300032092FreshwaterMSHIRIDKQKAVKKWAPVLENMGVTGERVDWMAEYAEFHSINE
Ga0334980_0120419_922_10833300033816FreshwaterMSHIRIDKQKAVKKWAPVLENMGVTGDRVEWLAEYAEFHSINENAYANVAIAGM
Ga0335003_0161244_2_1663300033995FreshwaterMSHIRIDKAKATKKWAPVLENMGVTGDRVEWMAEYAEFHSINENAYVNASNVAGM
Ga0334985_0506662_1_1293300034018FreshwaterMSHIRIDKQKAVKKWAPVLENMGVTGERAEWMAEYAEFHSINE
Ga0335001_0662647_380_5443300034064FreshwaterMSHIRIDKAKATKKWTPVLENMGVTGDRVEWMAEYAEFHSINENAYVNASNVAGM
Ga0335020_0265321_1_1653300034082FreshwaterMSNIRIDKQKALKKWSPVLENMGVAGEDRLDWMSEYAEFHSINENAYVNASLAGM
Ga0335022_0589195_2_1603300034095FreshwaterMAQIRIDQKKAVNKWSPVLENMGVTGDRVEWMSEMAEYHSINENAYANANIAG
Ga0335029_0062551_2543_27013300034102FreshwaterMSHIRIDKQKAVKKWAPVLENMGVTGDRVEWLAEYAEFHSINESAYANATTAG
Ga0335037_0696336_1_1173300034107FreshwaterMSHIRIDKSKATKKWAPVLENMGVTGEDRLDWMSEYAEY
Ga0335055_0430031_412_5403300034110FreshwaterMSHIRIDKSKATKKWAPVLENMGVTGEDRLDWMSEYAEYHSIN
Ga0335049_0563831_2_1213300034272FreshwaterMSHIRIDKSKAIKKWSPVLENMGVTGERVEWMAEYAEFHS
Ga0335039_0487608_514_6183300034355FreshwaterMSHIRIDKSKAMKKWSPVLENMGVSSDRFEWMSEM
Ga0335064_0858508_410_5503300034357FreshwaterMSHIRIDKQKAVKKWTPVLENMGVTGDRVEWMSELAEFHSINENAYA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.