Basic Information | |
---|---|
Family ID | F051412 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 144 |
Average Sequence Length | 41 residues |
Representative Sequence | MYHEICMAILPPHSLAETLRDWDEIAEQLAEPSRKRSRYAFC |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 92.36 % |
% of genes near scaffold ends (potentially truncated) | 23.61 % |
% of genes from short scaffolds (< 2000 bps) | 81.94 % |
Associated GOLD sequencing projects | 116 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.806 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (8.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.472 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.722 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.29% β-sheet: 0.00% Coil/Unstructured: 65.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF01609 | DDE_Tnp_1 | 70.14 |
PF03308 | MeaB | 1.39 |
PF02371 | Transposase_20 | 1.39 |
PF00872 | Transposase_mut | 1.39 |
PF07676 | PD40 | 1.39 |
PF13683 | rve_3 | 1.39 |
PF01869 | BcrAD_BadFG | 0.69 |
PF00571 | CBS | 0.69 |
PF02602 | HEM4 | 0.69 |
PF13646 | HEAT_2 | 0.69 |
PF00535 | Glycos_transf_2 | 0.69 |
PF07992 | Pyr_redox_2 | 0.69 |
PF13620 | CarboxypepD_reg | 0.69 |
PF03737 | RraA-like | 0.69 |
PF08388 | GIIM | 0.69 |
PF04932 | Wzy_C | 0.69 |
PF13744 | HTH_37 | 0.69 |
PF09137 | Glucodextran_N | 0.69 |
PF08031 | BBE | 0.69 |
PF01120 | Alpha_L_fucos | 0.69 |
PF13546 | DDE_5 | 0.69 |
PF10137 | TIR-like | 0.69 |
PF02915 | Rubrerythrin | 0.69 |
PF09594 | GT87 | 0.69 |
PF07883 | Cupin_2 | 0.69 |
PF08240 | ADH_N | 0.69 |
PF00263 | Secretin | 0.69 |
PF13419 | HAD_2 | 0.69 |
PF14294 | DUF4372 | 0.69 |
COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
---|---|---|---|
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 70.14 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 70.14 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 70.14 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 70.14 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 70.14 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 70.14 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.39 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.39 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.69 |
COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 0.69 |
COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.69 |
COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.81 % |
Unclassified | root | N/A | 13.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908028|beta3_all_NODE_116440_len_995_cov_8_909548 | Not Available | 1045 | Open in IMG/M |
2124908032|Perma_A_C_ConsensusfromContig170417 | Not Available | 1257 | Open in IMG/M |
2124908041|P3_CLC_ConsensusfromContig115453 | Not Available | 1232 | Open in IMG/M |
2140918008|ConsensusfromContig160145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1334 | Open in IMG/M |
3300000313|WSSedB1CaDRAFT_10028443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1117 | Open in IMG/M |
3300000567|JGI12270J11330_10081631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1523 | Open in IMG/M |
3300001199|J055_10087774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1246 | Open in IMG/M |
3300001213|JGIcombinedJ13530_101185726 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300001356|JGI12269J14319_10087735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1602 | Open in IMG/M |
3300001410|JGI20179J14886_1003776 | Not Available | 1340 | Open in IMG/M |
3300001580|Draft_10136468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1210 | Open in IMG/M |
3300002549|JGI24130J36418_10033122 | Not Available | 1475 | Open in IMG/M |
3300003995|Ga0055438_10108533 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300004080|Ga0062385_10250520 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300004091|Ga0062387_101332897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
3300005177|Ga0066690_10808457 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300005434|Ga0070709_10123185 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
3300005436|Ga0070713_100229836 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
3300005467|Ga0070706_100620343 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300005602|Ga0070762_10424784 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300006047|Ga0075024_100121227 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300006050|Ga0075028_100621055 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300006052|Ga0075029_100173198 | Not Available | 1337 | Open in IMG/M |
3300006162|Ga0075030_100153619 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
3300006162|Ga0075030_100288278 | Not Available | 1313 | Open in IMG/M |
3300006173|Ga0070716_100186749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1366 | Open in IMG/M |
3300006354|Ga0075021_10420522 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300006642|Ga0075521_10068979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1577 | Open in IMG/M |
3300009038|Ga0099829_10416870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1111 | Open in IMG/M |
3300009090|Ga0099827_10214823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1605 | Open in IMG/M |
3300009137|Ga0066709_100735989 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300009518|Ga0116128_1038035 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
3300009548|Ga0116107_1023880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2359 | Open in IMG/M |
3300009623|Ga0116133_1021341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1603 | Open in IMG/M |
3300009632|Ga0116102_1039663 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
3300010379|Ga0136449_100008109 | All Organisms → cellular organisms → Bacteria | 29854 | Open in IMG/M |
3300010379|Ga0136449_100307337 | All Organisms → cellular organisms → Bacteria | 2885 | Open in IMG/M |
3300010379|Ga0136449_100872672 | Not Available | 1472 | Open in IMG/M |
3300012202|Ga0137363_10749927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
3300012205|Ga0137362_10059918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3127 | Open in IMG/M |
3300012208|Ga0137376_11539131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 556 | Open in IMG/M |
3300012349|Ga0137387_10150750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1655 | Open in IMG/M |
3300012532|Ga0137373_10533529 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300012925|Ga0137419_10747456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
3300012929|Ga0137404_11053787 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300012944|Ga0137410_10422344 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300012964|Ga0153916_10916011 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300014159|Ga0181530_10123528 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300014164|Ga0181532_10069679 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
3300014199|Ga0181535_10817064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum → Pararhodospirillum photometricum DSM 122 | 528 | Open in IMG/M |
3300014201|Ga0181537_10163204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1529 | Open in IMG/M |
3300014490|Ga0182010_10032034 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
3300014492|Ga0182013_10151525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1462 | Open in IMG/M |
3300014501|Ga0182024_10622223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1347 | Open in IMG/M |
3300014501|Ga0182024_10669853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1286 | Open in IMG/M |
3300014501|Ga0182024_11007744 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300014501|Ga0182024_11354417 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300014502|Ga0182021_10200228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2332 | Open in IMG/M |
3300014502|Ga0182021_10369288 | Not Available | 1699 | Open in IMG/M |
3300014638|Ga0181536_10118910 | Not Available | 1453 | Open in IMG/M |
3300014658|Ga0181519_10082272 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
3300017823|Ga0187818_10049028 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300017931|Ga0187877_1028461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2836 | Open in IMG/M |
3300017934|Ga0187803_10032736 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
3300017934|Ga0187803_10037166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1934 | Open in IMG/M |
3300017946|Ga0187879_10231732 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300017972|Ga0187781_11447374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 509 | Open in IMG/M |
3300017998|Ga0187870_1130992 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300018005|Ga0187878_1072415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1475 | Open in IMG/M |
3300018018|Ga0187886_1037396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2372 | Open in IMG/M |
3300018021|Ga0187882_1185931 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300018023|Ga0187889_10429797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 569 | Open in IMG/M |
3300018082|Ga0184639_10428399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 680 | Open in IMG/M |
3300019242|Ga0181502_1286635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 619 | Open in IMG/M |
3300019270|Ga0181512_1485591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 515 | Open in IMG/M |
3300020579|Ga0210407_10364326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1131 | Open in IMG/M |
3300021433|Ga0210391_10431142 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300021476|Ga0187846_10079766 | Not Available | 1421 | Open in IMG/M |
3300021476|Ga0187846_10102475 | Not Available | 1231 | Open in IMG/M |
3300023259|Ga0224551_1005750 | All Organisms → cellular organisms → Bacteria | 2069 | Open in IMG/M |
3300024233|Ga0224521_1090208 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300025412|Ga0208194_1077376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 506 | Open in IMG/M |
3300025553|Ga0208080_1111654 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300025878|Ga0209584_10178702 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300025910|Ga0207684_10641418 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300025928|Ga0207700_10671555 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300027562|Ga0209735_1019852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1369 | Open in IMG/M |
3300027610|Ga0209528_1083431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 707 | Open in IMG/M |
3300027625|Ga0208044_1028910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1903 | Open in IMG/M |
3300027795|Ga0209139_10227000 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300027825|Ga0209039_10079676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1433 | Open in IMG/M |
3300027854|Ga0209517_10546790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300027879|Ga0209169_10152197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1205 | Open in IMG/M |
3300027884|Ga0209275_10305125 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300027905|Ga0209415_10147402 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
3300027911|Ga0209698_10161287 | Not Available | 1833 | Open in IMG/M |
3300027915|Ga0209069_10075826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
3300028047|Ga0209526_10321084 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300028536|Ga0137415_10051449 | All Organisms → cellular organisms → Bacteria | 3993 | Open in IMG/M |
3300028906|Ga0308309_10816328 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300029943|Ga0311340_10283147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1592 | Open in IMG/M |
3300029999|Ga0311339_11032936 | Not Available | 767 | Open in IMG/M |
3300030053|Ga0302177_10073317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2023 | Open in IMG/M |
3300030058|Ga0302179_10065528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1617 | Open in IMG/M |
3300030058|Ga0302179_10266018 | Not Available | 756 | Open in IMG/M |
3300030509|Ga0302183_10092267 | Not Available | 1194 | Open in IMG/M |
3300030618|Ga0311354_10169123 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
3300030879|Ga0265765_1011021 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300030943|Ga0311366_10736703 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300031231|Ga0170824_102073935 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300031234|Ga0302325_10014197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 16958 | Open in IMG/M |
3300031234|Ga0302325_10447673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1982 | Open in IMG/M |
3300031234|Ga0302325_10501613 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
3300031236|Ga0302324_100212848 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
3300031249|Ga0265339_10373656 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300031344|Ga0265316_10001887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 22010 | Open in IMG/M |
3300031344|Ga0265316_10054950 | All Organisms → cellular organisms → Bacteria | 3116 | Open in IMG/M |
3300031525|Ga0302326_11189200 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300031573|Ga0310915_10755031 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300031670|Ga0307374_10219804 | Not Available | 1324 | Open in IMG/M |
3300031707|Ga0315291_10223806 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
3300031707|Ga0315291_10728327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 876 | Open in IMG/M |
3300031708|Ga0310686_115599374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum alkenivorans | 2071 | Open in IMG/M |
3300031754|Ga0307475_10201181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1592 | Open in IMG/M |
3300031873|Ga0315297_10117024 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
3300031885|Ga0315285_10256157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1347 | Open in IMG/M |
3300031912|Ga0306921_11120431 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300031938|Ga0308175_100402825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1430 | Open in IMG/M |
3300032053|Ga0315284_11258382 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300032160|Ga0311301_10176195 | All Organisms → cellular organisms → Bacteria | 3756 | Open in IMG/M |
3300032160|Ga0311301_10541093 | Not Available | 1707 | Open in IMG/M |
3300032160|Ga0311301_11627937 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300032164|Ga0315283_11659884 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300032397|Ga0315287_10809908 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300032805|Ga0335078_10482127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1599 | Open in IMG/M |
3300032805|Ga0335078_10484379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1594 | Open in IMG/M |
3300032893|Ga0335069_11032635 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300033402|Ga0326728_10133540 | All Organisms → cellular organisms → Bacteria | 2779 | Open in IMG/M |
3300033480|Ga0316620_10411449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1225 | Open in IMG/M |
3300033486|Ga0316624_10223345 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
3300033743|Ga0334844_011987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1741 | Open in IMG/M |
3300033755|Ga0371489_0037782 | All Organisms → cellular organisms → Bacteria | 3428 | Open in IMG/M |
3300033982|Ga0371487_0019346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4750 | Open in IMG/M |
3300034125|Ga0370484_0029637 | Not Available | 1296 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.33% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.64% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.64% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.25% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.56% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.86% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.17% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.17% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.47% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.47% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.47% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 2.78% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.08% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.08% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.08% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.08% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.08% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.08% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.39% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.39% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.69% |
Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.69% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.69% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.69% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.69% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.69% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
3300000313 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001199 | Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001410 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 | Environmental | Open in IMG/M |
3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300019242 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033743 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9 | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
beta3_all_00159050 | 2124908028 | Soil | MFHEICMAILPPHSLAETLRDWDEIAQQLAEPNRKRSRYAFS |
Perma_A_C_01569340 | 2124908032 | Soil | MYHEICMAILPPHSLAETIRDWDEIAEKLAEPNRKRPRYAFS |
P3_CLC_01131740 | 2124908041 | Soil | MYHEICMAILPPHSLAETIRDWDEISEKLAEPNRKRPRYAFS |
Bog_all_C_00355300 | 2140918008 | Soil | MFHEVSMAILPPHSLAETLGDWDEIAEQLAEPSRKRLRYAFS |
WSSedB1CaDRAFT_100284431 | 3300000313 | Wetland | MYHEVCRAVLPSHSLAETLRDWDEISERLAEPSRRRSRY |
JGI12270J11330_100816313 | 3300000567 | Peatlands Soil | MYHEICMAILPPHSLAATLRNWDEITEQLAEPNRKRSRYAYN* |
J055_100877742 | 3300001199 | Lotic | MYHEICMAILPPHSLAETLRDWDEIAEQLAEPNRKRPRYVYY* |
JGIcombinedJ13530_1011857261 | 3300001213 | Wetland | MYHEICMAILPSHSLAETLRDWAEIAEQLAEPNRKRLRYAFW* |
JGI12269J14319_100877351 | 3300001356 | Peatlands Soil | MYHEICMAILPPHSLAATLRDWDEITEQLAEPNRKRSRYAYN* |
JGI20179J14886_10037761 | 3300001410 | Arctic Peat Soil | MFHEICMAILPPHSLAETLRDWDEIAQQLAEPNRKRSRYAFS* |
Draft_101364682 | 3300001580 | Hydrocarbon Resource Environments | MYHEICMAILPSHSLAETLRDWDEIAEQLAEPNRKRLRYAFW* |
JGI24130J36418_100331221 | 3300002549 | Arctic Peat Soil | MYHEICMAILPPHSLAETIRDWDEISEKLAEPNRKRPRYAFS* |
Ga0055438_101085331 | 3300003995 | Natural And Restored Wetlands | MFHEVGMTILPAHSLSETFSDWDEIQEQLAEPSRQRQRYAFC* |
Ga0062385_102505202 | 3300004080 | Bog Forest Soil | MFHEVSMSILPPHSLAETLGDWDEIAEQLAEPSRKRLRYAFS* |
Ga0062387_1013328972 | 3300004091 | Bog Forest Soil | MYHEICMAILPPHSLAETLRDWDEIAERLAEPNRKRPRYVSY |
Ga0066690_108084571 | 3300005177 | Soil | MYHEICMAILPPHSLAATLGDWDEISEQLAEPNRKRPRYSFLLS* |
Ga0070709_101231853 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MYHEICMAILPHHSLAETLRDWDEIAVRLAEPNRKRPRYAFY* |
Ga0070713_1002298362 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MYHEICMAILPHHSLAETLRDWDEIAVQLAEPNRKRPRYALC* |
Ga0070706_1006203432 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MYHEVCMAILPPHSLAETLRDWDEIVEQLAEPNRKRLRYAFFLS* |
Ga0070762_104247841 | 3300005602 | Soil | MFHEVSMAILPPHSLAETLGDWDEIAEQLAEPSRKRLRYVFS* |
Ga0075024_1001212273 | 3300006047 | Watersheds | MYHEICMAILPPHSLAETFRDWDEIAEQLAEPNRKRPRYAFH* |
Ga0075028_1006210552 | 3300006050 | Watersheds | MYHEICMAILPPHSLAETFRDWDEIAEQLAEPNRKRPRYAFY* |
Ga0075029_1001731982 | 3300006052 | Watersheds | MYHEICMAILPPHDLAEVLRDWDEIARQLAEPSRQRPRYAFS* |
Ga0075030_1001536193 | 3300006162 | Watersheds | MYHELCTAIQPPHNLSETFRDWQEIAEQLAEPSRKRSRYTFC* |
Ga0075030_1002882781 | 3300006162 | Watersheds | MYHEICMAILPPHDLAEVLRDWDEIARQLAEPSRQRPRYAFY* |
Ga0070716_1001867492 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MYHEICMAILPHHSLAETLRDWDEIAVRLAEPNRKRRRYAFY* |
Ga0075021_104205221 | 3300006354 | Watersheds | MYHEICMAILPRHSLAETLRDWDEIAKQLAEPNRKRSRYVY |
Ga0075521_100689793 | 3300006642 | Arctic Peat Soil | MFHEICMAIMPPHGLAETLRDWDELKELLAEPSRKRPRYVFC* |
Ga0099829_104168702 | 3300009038 | Vadose Zone Soil | MYHEVCMAILPPHRLAETLRDWDEIAEQLAEPSRKRPRYAFR* |
Ga0099827_102148231 | 3300009090 | Vadose Zone Soil | MYHEICMAILPPHSLAETLRDWDEIAEQLAEPNRKRPRYAFY* |
Ga0066709_1007359893 | 3300009137 | Grasslands Soil | MAILPPHELAETFSDWVEISEGLDEPNRKRLRYAFF* |
Ga0116128_10380352 | 3300009518 | Peatland | MYHQVCTAIQPPHSLAETFRDWDEITEQLAESSRNRSRYGFS* |
Ga0116107_10238804 | 3300009548 | Peatland | IQPPHSLAETFRDWDEITEQLAESSRNRSRYGFS* |
Ga0116133_10213412 | 3300009623 | Peatland | MYHEVCMAILPPHGLAETFRDWDEISERLAEPNRKRPRYAFS* |
Ga0116102_10396634 | 3300009632 | Peatland | MYHEICMATLPAHGLAETLRDWDEISERLSEPTRSRARYDFR* |
Ga0136449_10000810923 | 3300010379 | Peatlands Soil | MFHEVRMAILPPHSLAETLGDWDEITEQLAEPSRKRQRYAFH* |
Ga0136449_1003073374 | 3300010379 | Peatlands Soil | MYHQVCTAIQPPHGLAETFRDWDEITEQLAESSRNRWRYGFS* |
Ga0136449_1008726722 | 3300010379 | Peatlands Soil | MFHELRTAILPSHSLAETFGDWDEIAEQLAEPSRKRLRYAFS* |
Ga0137363_107499273 | 3300012202 | Vadose Zone Soil | MYHELCMAILPPHSLNDTFRDWDEISERLAEPSRKRPRYAF |
Ga0137362_100599181 | 3300012205 | Vadose Zone Soil | MYHEICLAILPTHSLAETLRDWDEIAEQLAEPRRKRSRYAYY* |
Ga0137376_115391312 | 3300012208 | Vadose Zone Soil | MYHEICMAILPPHGLAETLRDWDEIARQLAEPSRKRPRYAFS* |
Ga0137387_101507503 | 3300012349 | Vadose Zone Soil | MYHELCMAILPPHNLNDIFRDWDEISERLAEPSRKRPRYVFC* |
Ga0137373_105335292 | 3300012532 | Vadose Zone Soil | MFHEVCMAILPPHSLAATLGDWDEIAEQLAEPRRKRLRYAFS* |
Ga0137419_107474561 | 3300012925 | Vadose Zone Soil | MYHELCMAILPPHSLNDIFRDWDEISERLAEPSRKRPRYVFC* |
Ga0137404_110537872 | 3300012929 | Vadose Zone Soil | MYHEICLAILPPHSLAETLGDWDEIAEQLAEPNRKRPRYVVY* |
Ga0137410_104223441 | 3300012944 | Vadose Zone Soil | IEFMYHEVCMAILPPHSLAEIVRDWDEIAEQLAEPNRKRSRYVFS* |
Ga0153916_109160111 | 3300012964 | Freshwater Wetlands | MYHEICMAILPPHSLAETLRDWDEIARQLAEPGRKRSRFAYC* |
Ga0181530_101235282 | 3300014159 | Bog | ATLPAHGLAETLRDWDEISERLSEPTRSRARYDFR* |
Ga0181532_100696791 | 3300014164 | Bog | MYHDVCMAILPPHSLAETLRDWDEIAEQLAEPNRKRSRYVFS* |
Ga0181535_108170641 | 3300014199 | Bog | EICMAIVPPHGMAETLRGWNELKELLAEPARKRQR* |
Ga0181537_101632042 | 3300014201 | Bog | MFHEVSMAILPPHSLAETFGDWDEIAEQLAEPSRKRLRYAFS* |
Ga0182010_100320343 | 3300014490 | Fen | MFHEICMAILPPHNLAETLRDWDEIAQQLAEPNRKRSRYAFC* |
Ga0182013_101515251 | 3300014492 | Bog | MYHEICMAILPQHSLAETLRDWDEIAEQLAEPNRKRPRYVFY* |
Ga0182024_106222231 | 3300014501 | Permafrost | MFNEIRMAIPPPHSLAETFKDWDEIVGQLAEPSRKRLGYAFS* |
Ga0182024_106698531 | 3300014501 | Permafrost | MYHEICMAILPPHSLAETFRDWAEIADQLAEPNRERSRYAYN* |
Ga0182024_110077443 | 3300014501 | Permafrost | AILPPHSLAETFRDWAEIADQLAEPNRERSRYAYN* |
Ga0182024_113544172 | 3300014501 | Permafrost | MFHEVSMAILPPHSLAETFGDWDEIAEQLAEPSRKRRRYAFS* |
Ga0182021_102002282 | 3300014502 | Fen | MYHQVCTAIQPPHGLAETFRDWDEITEQLAESSRNRSRYGFS* |
Ga0182021_103692882 | 3300014502 | Fen | MFHNICMAILPPHNLADTLRDWDEIKELLAEPSRKRRRYAFS* |
Ga0181536_101189101 | 3300014638 | Bog | MATLPAHGLAETLRDWDEISERLSEPTRSRARCDFR* |
Ga0181519_100822723 | 3300014658 | Bog | MFHEVSMAILPPSHLAEILGDWGEIAEQLAEPSRKRLRYAFY* |
Ga0187818_100490282 | 3300017823 | Freshwater Sediment | MYHEVCEAILPRHSLAETFRDWDEIAEQLAESSRQRSRYVFY |
Ga0187877_10284613 | 3300017931 | Peatland | MYHQVCTAIQPPHSLAETFRDWDEITEQLAESSRNRSRYGFS |
Ga0187803_100327363 | 3300017934 | Freshwater Sediment | MYHEVCEAILPRHSLAETFRDWDEIVEQLAESSRQRSRYVFY |
Ga0187803_100371662 | 3300017934 | Freshwater Sediment | MYHELCIAILPPHTLAETFRDWDEIAQRLAEPNRKRPRYAFY |
Ga0187879_102317322 | 3300017946 | Peatland | MHHEVCAAILPPHNLAETLRDWDEIAGQLAEPSRKRKRYVFY |
Ga0187781_114473741 | 3300017972 | Tropical Peatland | MYHELCAAIPAPHKLSGTLRDWGEISEQLAEPSRRRSRY |
Ga0187870_11309922 | 3300017998 | Peatland | MYHEVCMAVLPPHTLAQTFGDWDEIADQLAEPNRKRPRYAFC |
Ga0187878_10724151 | 3300018005 | Peatland | MYHQLCTAIQPPHGLAETFRDWDEITEQLAESSRNR |
Ga0187886_10373962 | 3300018018 | Peatland | MYHQLCTAIQPPHGLAETFRDWDEITEQLAESSRNRSRYGFP |
Ga0187882_11859311 | 3300018021 | Peatland | MYHEVCMAILPPHGLAETFRDWDEISERLAEPNRKR |
Ga0187889_104297972 | 3300018023 | Peatland | MYHEVCMAILPPHGLAETFRDWDEISERLAEPNRKRPRYAFS |
Ga0184639_104283992 | 3300018082 | Groundwater Sediment | MYHEICMAILPPHSLAETFRDWDEIAEQLAEPNRKRPRYAFY |
Ga0181502_12866353 | 3300019242 | Peatland | MFHEVSMAILPPSHLAEILGDWGEIAEQLAEPSRKRLRYAFY |
Ga0181512_14855911 | 3300019270 | Peatland | MFHEVSMAILPPHSLAETFGDWDEIAEQLAEPSRKRLRYAFS |
Ga0210407_103643262 | 3300020579 | Soil | MYHEVCKAILPDCNLAETLRDWDEIAEGLAEPRRKRSRYG |
Ga0210391_104311422 | 3300021433 | Soil | MLHEVSMAILPPHSLAETLGDWDEIAEQLAEPSRKRLRYVFS |
Ga0187846_100797662 | 3300021476 | Biofilm | MYHELCTAIQPPHNLSETFRDWHEIAEQLAEPSRKRSRYIFS |
Ga0187846_101024751 | 3300021476 | Biofilm | MYHEVCMAILPSHSLVETLRDWDEISERLAEPSRKRLRYHFSLS |
Ga0224551_10057504 | 3300023259 | Soil | MFNEIRMAIPPPHSLAETFKDWDEIVGQLAEPSRKRLRYAFS |
Ga0224521_10902082 | 3300024233 | Soil | MFHEICMAILPPHNLAETLRDWDEIAQQLAEPNRKRSRYAFC |
Ga0208194_10773762 | 3300025412 | Peatland | MYHEVCMAILPPHGLAETFRDWDEISERLAEPNRKRPRYA |
Ga0208080_11116542 | 3300025553 | Arctic Peat Soil | MYHEICMAILPPHSLAETIRDWDEISEKLAEPNRKRPRYAF |
Ga0209584_101787022 | 3300025878 | Arctic Peat Soil | MFHEICMAILPPHNLAETLRAWDEFKELLAEASRKRRRYAFS |
Ga0207684_106414181 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MYHEVCMAILPPHSLAETLRDWDEIVEQLAEPNRKRLRYAFFLS |
Ga0207700_106715552 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MYHEICMAILPHHSLAETLRDWDEIAVQLAEPNRKRPRYALC |
Ga0209735_10198523 | 3300027562 | Forest Soil | MFHEVCMAILPPHNLAEAFRDWDQIAERLAEPNRKRSRYAFS |
Ga0209528_10834312 | 3300027610 | Forest Soil | MYHEVCMAIFPPHGLVETFRDWDEISERLAEPSRKRLRYAFS |
Ga0208044_10289102 | 3300027625 | Peatlands Soil | MYHEICMAILPPHSLAATLRDWDEITEQLAEPNRKRSRYAYN |
Ga0209139_102270001 | 3300027795 | Bog Forest Soil | MFHEVSMSILPPHSLAETLGDWDEIAEQLAEPSRKRLRY |
Ga0209039_100796761 | 3300027825 | Bog Forest Soil | MFREVSMAILPPHSLAETLGDWDEIAEQLAEPSRKRLRYAFS |
Ga0209517_105467903 | 3300027854 | Peatlands Soil | AILPPHSLAATLRDWDEITEQLAEPNRKRSRYAYN |
Ga0209169_101521971 | 3300027879 | Soil | MFHEVSMAILPPHSLAETFGDWDEIADQLAEPSRKRLRYALS |
Ga0209275_103051251 | 3300027884 | Soil | MFHEVSMAILPPHSLAETLGDWDEIAEQLAEPSRKRLRYVFS |
Ga0209415_101474022 | 3300027905 | Peatlands Soil | MYHQLCTAIQPPHGLAETFRDWDEITEQLAESSRNRSRYGFS |
Ga0209698_101612871 | 3300027911 | Watersheds | MYHEICMAILPPHDLAEVLRDWDEIARQLAEPSRQRPRYAFS |
Ga0209069_100758263 | 3300027915 | Watersheds | MYHEICMAILPPHSLAETFRDWDEIAEQLAEPNRKRPRYAFH |
Ga0209526_103210842 | 3300028047 | Forest Soil | MFHEICMAILPRHSLAETFRDWDEITVQLAEPSRKRRRYAFY |
Ga0137415_100514493 | 3300028536 | Vadose Zone Soil | MYHELCMAILPPHSLNDIFRDWDEISERLAEPSRKRPRYVFC |
Ga0308309_108163281 | 3300028906 | Soil | MYHEVCMAILPPQSLAETLRDWDEIAEQLAEPNRTR |
Ga0311340_102831473 | 3300029943 | Palsa | MFHEVSMAILPPHSLAETFGDWDEIAEQLAEPSRKRLRYA |
Ga0311339_110329362 | 3300029999 | Palsa | AILPPHSLAETFGDWDEIAEQLAEPSRKRLRYAFS |
Ga0302177_100733172 | 3300030053 | Palsa | MFHEVSMAILPPHSLAETFGDWDEIAEQLAEPSRKRLRYAFFLS |
Ga0302179_100655283 | 3300030058 | Palsa | MFHEVRMAILPPHSLAETFGDWDEIAEQLAEPSRKRLRYAFF |
Ga0302179_102660181 | 3300030058 | Palsa | EFMFHEVRMAILPPHSLAETFGDWDEIAEQLAEPSRKRLRYAFS |
Ga0302183_100922671 | 3300030509 | Palsa | MFHEVSMAILPPHSLAETFGDWDEIAEQLAEPSRKR |
Ga0311354_101691233 | 3300030618 | Palsa | MFHEVRMAILPPHSLAETFGDWDEIAEQLAEPSRKRLRYAFS |
Ga0265765_10110212 | 3300030879 | Soil | MFHEIRMAILPPHSLVETFRDWEEIIVQLAEPSRKRPRYVNS |
Ga0311366_107367031 | 3300030943 | Fen | MFHEICMAILPPHSLAEALRDWDELKELLAEPSRKRSRYAFS |
Ga0170824_1020739352 | 3300031231 | Forest Soil | MYHEICMAILPPHGLAETFRDWDEISERLAEPNRKRLRYAFY |
Ga0302325_1001419715 | 3300031234 | Palsa | MYHEVCMAILPPHSLAETLRDWDEIAEQLAEPNRKRARYVFLS |
Ga0302325_104476734 | 3300031234 | Palsa | ILPPHSLAETFGDWDEIAEQLAEPSRKRLRYAFFLS |
Ga0302325_105016132 | 3300031234 | Palsa | MFHEMCMAIAPPHSLADTFRDWDEIIVRLAEPSRKRPRFANFLS |
Ga0302324_1002128481 | 3300031236 | Palsa | MFHEVRMAILPPHSLAETFGDWDEIAEQLAEPSRKRLRYAFFLS |
Ga0265339_103736562 | 3300031249 | Rhizosphere | TEFMYHELCKAILPSHSLVETLRDWDEISERLAEPSRKRIRYVYC |
Ga0265316_1000188713 | 3300031344 | Rhizosphere | MYHELCKAILPSHSLVETLRDWDEISERLAEPSRKRIRYVYC |
Ga0265316_100549503 | 3300031344 | Rhizosphere | MFHEICMAILPPHSLAETLRAWDEIKELLAEASRKRRRYAFY |
Ga0302326_111892001 | 3300031525 | Palsa | MYHEVCMAILPPHSLAETLRDWDEIAEQLAEPNRTRPRYVFY |
Ga0310915_107550311 | 3300031573 | Soil | MFHEVRMAILPFHSLAEILGDWDEIAEQLAEPSRQRLRYFYS |
Ga0307374_102198041 | 3300031670 | Soil | MYHELCMAILPPHSLSGTFRDWDEISERLAEPGRKRPRYVFC |
Ga0315291_102238062 | 3300031707 | Sediment | MYHEICMAILPPHSLAGTLRDWDKIAEQLAEPNRKRPRYAFS |
Ga0315291_107283272 | 3300031707 | Sediment | MYHEICMAILPPHSLAETLRAWDEIAEQLAEPSRERSRYAFC |
Ga0310686_1155993742 | 3300031708 | Soil | MFHEISMAILPPHSLAETFRDWAEIAGKLAEPSRKRLRYAFS |
Ga0307475_102011812 | 3300031754 | Hardwood Forest Soil | MFHEICMAILPRHSLAETLRDWDEITVQLAEPSRKRRRYAFS |
Ga0315297_101170242 | 3300031873 | Sediment | MYHEICMAILPPHSLAGTLRDWDKISEQLAEPNRKRPRYAFS |
Ga0315285_102561572 | 3300031885 | Sediment | MYHEICMAILPPHSLAETLRDWDEIAEQLAEPNRKRSRYAYS |
Ga0306921_111204311 | 3300031912 | Soil | MFHEVRMAILPFHSLAEILGDWDEIAEQLAEPSRQRL |
Ga0308175_1004028252 | 3300031938 | Soil | MFHEIGMAISPVHSLSETFRDWDEIQEQLAEPSRRRRRYVFS |
Ga0315284_112583822 | 3300032053 | Sediment | MYHEICMAILPPHSLAKTLRDWNEIARQLAEPGRKRSRYAYR |
Ga0311301_101761951 | 3300032160 | Peatlands Soil | MFHEVRMAILPPHSLAETLGDWDEITEQLAEPSRKRQRYAFH |
Ga0311301_105410932 | 3300032160 | Peatlands Soil | MFHELRTAILPSHSLAETFGDWDEIAEQLAEPSRKRLRYAFS |
Ga0311301_116279371 | 3300032160 | Peatlands Soil | MYHQLCTAIQPPHGLAETFRDWDEITEQLAESSRNRSRYGF |
Ga0315283_116598842 | 3300032164 | Sediment | MYHEICMAILPPHSLAETLRDWDEIAEQLAEPNRK |
Ga0315287_108099082 | 3300032397 | Sediment | MYHEICMAILPPHSLAETLRDWDEIAEQLAEPSRKRSRYAFC |
Ga0335078_104821271 | 3300032805 | Soil | MFHEVRMAILPPHSLAETLGDWDEIAEQLAEPSRKRPRYAFS |
Ga0335078_104843791 | 3300032805 | Soil | MYHEVCKAILPSHSLVETLRDWDEISERLAEPTRRRIRYAYR |
Ga0335069_110326352 | 3300032893 | Soil | MYHEVCKAILPSHRLVETFRDWDEISERLAEPSRRRTRYAYR |
Ga0326728_101335401 | 3300033402 | Peat Soil | MFHEICMAIMPPHGLAEVLRDWDELKELLAEPNRKRPRYVFC |
Ga0316620_104114491 | 3300033480 | Soil | MYHEICMAILPPHSLAETLGDWTEIAEQLAEPNRKRP |
Ga0316624_102233452 | 3300033486 | Soil | MYHEICMAILPPHSLAETLRDWDEIARQLAEPGRKRSRYAYC |
Ga0334844_011987_120_248 | 3300033743 | Soil | MFHEICMAILPPHNLAETLRDWDEIAQQLAEPNRKRSRYAFS |
Ga0371489_0037782_2099_2227 | 3300033755 | Peat Soil | MHHEICMAILPPHRLAETLRDWDEIAEHLAEPSRKRSRYAYR |
Ga0371487_0019346_626_742 | 3300033982 | Peat Soil | MFHEICMAIVPPHGMAETLRGWNELKELLAEPARKRQR |
Ga0370484_0029637_1180_1296 | 3300034125 | Untreated Peat Soil | MYHEMCMAILPPHRLVETFRDWDEIVEKLAEPNRQRLRH |
⦗Top⦘ |