NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F052029

Metagenome Family F052029

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F052029
Family Type Metagenome
Number of Sequences 143
Average Sequence Length 49 residues
Representative Sequence LALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Number of Associated Samples 126
Number of Associated Scaffolds 143

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 40.56 %
% of genes near scaffold ends (potentially truncated) 50.35 %
% of genes from short scaffolds (< 2000 bps) 76.92 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (50.350 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.888 % of family members)
Environment Ontology (ENVO) Unclassified
(32.867 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.259 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.75%    β-sheet: 0.00%    Coil/Unstructured: 51.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 143 Family Scaffolds
PF00581Rhodanese 22.38
PF02272DHHA1 9.79
PF13409GST_N_2 4.20
PF01039Carboxyl_trans 4.20
PF13417GST_N_3 3.50
PF00293NUDIX 3.50
PF03320FBPase_glpX 2.10
PF06823DUF1236 2.10
PF12244DUF3606 2.10
PF03401TctC 0.70
PF07883Cupin_2 0.70
PF00483NTP_transferase 0.70
PF12680SnoaL_2 0.70

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 143 Family Scaffolds
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 4.20
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 4.20
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 4.20
COG1494Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related proteinCarbohydrate transport and metabolism [G] 2.10
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.70

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A50.35 %
All OrganismsrootAll Organisms49.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2001200001|2001242521Not Available1035Open in IMG/M
3300000041|ARcpr5oldR_c000040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales25011Open in IMG/M
3300000045|ARCol0oldRDRAFT_c00447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3919Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104981713All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300000890|JGI11643J12802_12214745Not Available671Open in IMG/M
3300000953|JGI11615J12901_11073965Not Available861Open in IMG/M
3300002074|JGI24748J21848_1003938Not Available1703Open in IMG/M
3300002076|JGI24749J21850_1007064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1562Open in IMG/M
3300002155|JGI24033J26618_1000912All Organisms → cellular organisms → Bacteria2840Open in IMG/M
3300002820|JGI25490J38602_10103Not Available620Open in IMG/M
3300004009|Ga0055437_10044804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1163Open in IMG/M
3300004019|Ga0055439_10021281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1560Open in IMG/M
3300004020|Ga0055440_10159250Not Available570Open in IMG/M
3300004070|Ga0055488_10017108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1296Open in IMG/M
3300004114|Ga0062593_100687865Not Available995Open in IMG/M
3300004114|Ga0062593_101054862Not Available839Open in IMG/M
3300004114|Ga0062593_101089251Not Available828Open in IMG/M
3300004114|Ga0062593_102762665Not Available560Open in IMG/M
3300004156|Ga0062589_101967356Not Available592Open in IMG/M
3300005146|Ga0066817_1007172Not Available821Open in IMG/M
3300005148|Ga0066819_1026717Not Available511Open in IMG/M
3300005161|Ga0066807_1036384Not Available550Open in IMG/M
3300005162|Ga0066814_10004902All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300005164|Ga0066815_10066640Not Available625Open in IMG/M
3300005185|Ga0066811_1021213Not Available557Open in IMG/M
3300005213|Ga0068998_10048990Not Available828Open in IMG/M
3300005290|Ga0065712_10013255All Organisms → cellular organisms → Bacteria2452Open in IMG/M
3300005290|Ga0065712_10159567All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300005329|Ga0070683_101769126Not Available594Open in IMG/M
3300005332|Ga0066388_102355916All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300005338|Ga0068868_100520046All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300005347|Ga0070668_101523205Not Available611Open in IMG/M
3300005458|Ga0070681_11369352Not Available631Open in IMG/M
3300005530|Ga0070679_102161341Not Available506Open in IMG/M
3300005539|Ga0068853_102147030Not Available541Open in IMG/M
3300005617|Ga0068859_100423865Not Available1427Open in IMG/M
3300005713|Ga0066905_100088450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2061Open in IMG/M
3300005713|Ga0066905_100131166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1769Open in IMG/M
3300005719|Ga0068861_101577447Not Available646Open in IMG/M
3300006042|Ga0075368_10520864Not Available532Open in IMG/M
3300006195|Ga0075366_10816141Not Available580Open in IMG/M
3300006196|Ga0075422_10268601Not Available722Open in IMG/M
3300006804|Ga0079221_10361470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae882Open in IMG/M
3300009092|Ga0105250_10111707Not Available1119Open in IMG/M
3300009101|Ga0105247_10513337Not Available875Open in IMG/M
3300009156|Ga0111538_10065948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14624612Open in IMG/M
3300009174|Ga0105241_10635932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.968Open in IMG/M
3300009174|Ga0105241_10790834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.873Open in IMG/M
3300009551|Ga0105238_12987120Not Available508Open in IMG/M
3300010046|Ga0126384_11791020Not Available583Open in IMG/M
3300010046|Ga0126384_11907806Not Available566Open in IMG/M
3300010047|Ga0126382_12266157Not Available524Open in IMG/M
3300010047|Ga0126382_12501953Not Available503Open in IMG/M
3300010362|Ga0126377_10052494All Organisms → cellular organisms → Bacteria3560Open in IMG/M
3300010399|Ga0134127_10036990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3950Open in IMG/M
3300010400|Ga0134122_10619148Not Available1003Open in IMG/M
3300012477|Ga0157336_1024899Not Available566Open in IMG/M
3300012480|Ga0157346_1002463All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300012884|Ga0157300_1107460Not Available523Open in IMG/M
3300012899|Ga0157299_10004269All Organisms → cellular organisms → Bacteria → Proteobacteria2149Open in IMG/M
3300012899|Ga0157299_10039482Not Available1007Open in IMG/M
3300012904|Ga0157282_10000134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14628555Open in IMG/M
3300012909|Ga0157290_10186720Not Available694Open in IMG/M
3300012915|Ga0157302_10486704Not Available530Open in IMG/M
3300012916|Ga0157310_10007819All Organisms → cellular organisms → Bacteria2508Open in IMG/M
3300012943|Ga0164241_11215769Not Available557Open in IMG/M
3300012951|Ga0164300_10030705All Organisms → cellular organisms → Bacteria → Proteobacteria1969Open in IMG/M
3300012958|Ga0164299_10000144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root146214334Open in IMG/M
3300013102|Ga0157371_10187828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1479Open in IMG/M
3300013105|Ga0157369_11137218All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300013105|Ga0157369_11955763Not Available595Open in IMG/M
3300014299|Ga0075303_1079209Not Available608Open in IMG/M
3300014324|Ga0075352_1017734Not Available1453Open in IMG/M
3300014745|Ga0157377_11702549Not Available509Open in IMG/M
3300015371|Ga0132258_10186893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes5014Open in IMG/M
3300015371|Ga0132258_13221552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1125Open in IMG/M
3300015371|Ga0132258_13374547Not Available1097Open in IMG/M
3300015372|Ga0132256_100189308All Organisms → cellular organisms → Bacteria2097Open in IMG/M
3300015372|Ga0132256_100350068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1571Open in IMG/M
3300015373|Ga0132257_101588964All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300019356|Ga0173481_10001333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68605894Open in IMG/M
3300019361|Ga0173482_10000043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root146218734Open in IMG/M
3300019361|Ga0173482_10078996Not Available1146Open in IMG/M
3300019362|Ga0173479_10000355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales8819Open in IMG/M
3300022883|Ga0247786_1094055Not Available643Open in IMG/M
3300022886|Ga0247746_1000775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes4884Open in IMG/M
3300022886|Ga0247746_1063718Not Available863Open in IMG/M
3300022899|Ga0247795_1060910Not Available642Open in IMG/M
3300023077|Ga0247802_1000059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14626325Open in IMG/M
3300023168|Ga0247748_1001023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2967Open in IMG/M
3300023261|Ga0247796_1005125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1752Open in IMG/M
3300025535|Ga0207423_1013727Not Available1278Open in IMG/M
3300025900|Ga0207710_10689825Not Available535Open in IMG/M
3300025907|Ga0207645_10001225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root146221129Open in IMG/M
3300025907|Ga0207645_10078014All Organisms → cellular organisms → Bacteria2122Open in IMG/M
3300025910|Ga0207684_11334288All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300025914|Ga0207671_10302423All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300025917|Ga0207660_11021397Not Available674Open in IMG/M
3300025918|Ga0207662_10484270Not Available850Open in IMG/M
3300025920|Ga0207649_11180357Not Available605Open in IMG/M
3300025920|Ga0207649_11307662Not Available573Open in IMG/M
3300025921|Ga0207652_11736763Not Available529Open in IMG/M
3300025926|Ga0207659_11187179Not Available656Open in IMG/M
3300025930|Ga0207701_10298726All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300025937|Ga0207669_10000470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root146217605Open in IMG/M
3300025979|Ga0210078_1028180All Organisms → cellular organisms → Bacteria → Terrabacteria group745Open in IMG/M
3300026035|Ga0207703_11255934Not Available712Open in IMG/M
3300026078|Ga0207702_12391156Not Available516Open in IMG/M
3300026088|Ga0207641_10011001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7420Open in IMG/M
3300026095|Ga0207676_11147164Not Available769Open in IMG/M
3300026452|Ga0256821_1024859Not Available648Open in IMG/M
3300026759|Ga0207527_102977All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300026940|Ga0207521_101103Not Available918Open in IMG/M
3300026995|Ga0208761_1000505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1799Open in IMG/M
3300027385|Ga0207540_100769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales908Open in IMG/M
3300027397|Ga0207463_100631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales963Open in IMG/M
3300027403|Ga0207609_100416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1172Open in IMG/M
3300027433|Ga0207618_100345All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300027435|Ga0207553_1001277All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300027482|Ga0207460_101819Not Available695Open in IMG/M
3300027483|Ga0207637_1003601Not Available783Open in IMG/M
3300027523|Ga0208890_1015334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1062Open in IMG/M
3300027695|Ga0209966_1063722Not Available800Open in IMG/M
3300027866|Ga0209813_10434614Not Available534Open in IMG/M
3300027876|Ga0209974_10352464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria571Open in IMG/M
3300027907|Ga0207428_10009870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14628552Open in IMG/M
3300028381|Ga0268264_11764151Not Available629Open in IMG/M
(restricted) 3300031197|Ga0255310_10003917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3891Open in IMG/M
3300031226|Ga0307497_10503197Not Available598Open in IMG/M
(restricted) 3300031248|Ga0255312_1007213All Organisms → cellular organisms → Bacteria2653Open in IMG/M
3300031547|Ga0310887_10188335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1112Open in IMG/M
3300031716|Ga0310813_10035680All Organisms → cellular organisms → Bacteria3556Open in IMG/M
3300031892|Ga0310893_10007536All Organisms → cellular organisms → Bacteria2861Open in IMG/M
3300031913|Ga0310891_10000397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7787Open in IMG/M
3300031940|Ga0310901_10355213Not Available628Open in IMG/M
3300032013|Ga0310906_10006695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4116Open in IMG/M
3300032144|Ga0315910_10823694Not Available722Open in IMG/M
3300032179|Ga0310889_10044184All Organisms → cellular organisms → Bacteria1710Open in IMG/M
3300033004|Ga0335084_10200500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2072Open in IMG/M
3300033551|Ga0247830_11578660Not Available525Open in IMG/M
3300034692|Ga0373917_0011214All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300034818|Ga0373950_0033080All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300034819|Ga0373958_0000032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales14582Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil11.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.59%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.20%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.50%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.10%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.10%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.10%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.10%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.10%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.40%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.40%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil1.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.40%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.40%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.40%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.40%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.40%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.40%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.40%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.70%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.70%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.70%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.70%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2001200001Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150EnvironmentalOpen in IMG/M
3300000041Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphereHost-AssociatedOpen in IMG/M
3300000045Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphereHost-AssociatedOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300002076Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3Host-AssociatedOpen in IMG/M
3300002155Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7Host-AssociatedOpen in IMG/M
3300002820Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004020Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005146Soil and rhizosphere microbial communities from Laval, Canada - mgHABEnvironmentalOpen in IMG/M
3300005148Soil and rhizosphere microbial communities from Laval, Canada - mgLMAEnvironmentalOpen in IMG/M
3300005161Soil and rhizosphere microbial communities from Laval, Canada - mgLPAEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005185Soil and rhizosphere microbial communities from Laval, Canada - mgHPBEnvironmentalOpen in IMG/M
3300005213Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012480Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610Host-AssociatedOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300025535Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025979Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026452Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4EnvironmentalOpen in IMG/M
3300026759Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026940Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300027385Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027397Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027403Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027433Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027435Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K3-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027482Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A2w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027483Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034692Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3EngineeredOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
20012746652001200001SoilLPLNFRSILPADPVAQQEIDNSGALSEQFVTICAASLALLVVAAIAALMGMA
ARcpr5oldR_00004063300000041Arabidopsis RhizosphereLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
ARCol0oldRDRAFT_0044763300000045Arabidopsis RhizosphereLALNFRSLLPANPVAQQEINNTGALSEQLVMIGAASLALLVVAAIAVLMGMA*
INPhiseqgaiiFebDRAFT_10498171313300000364SoilLAFDFRSILPANPVTQQKINDTGALSDQLVTVGAASLALIAVAAIAILMGMV*
JGI11643J12802_1221474513300000890SoilLPLNFRSILPADPIAQQEINNAGAPSEQFVMIGAASLALLVVVA
JGI11615J12901_1107396523300000953SoilLPAEPVAQQEASNTGALSEQFVTVGAASLALLVVAAIAVLMGMA*
JGI24748J21848_100393843300002074Corn, Switchgrass And Miscanthus RhizosphereNRGAPLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIGMA*
JGI24749J21850_100706413300002076Corn, Switchgrass And Miscanthus RhizospherePLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIGMA*
JGI24033J26618_100091213300002155Corn, Switchgrass And Miscanthus RhizosphereLPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLMEWLESL
JGI25490J38602_1010313300002820SoilLALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0055437_1004480433300004009Natural And Restored WetlandsLALNFKSILPADPVAQQEANNTGALSEQFVTIGAASLALLVVAAIAVLMGMA*
Ga0055439_1002128113300004019Natural And Restored WetlandsLNFKSILPADPVAQQEANNTGALSEQFVTIGAASLALLVVAAIAVLMGMA*
Ga0055440_1015925013300004020Natural And Restored WetlandsLALNFKSILPADPVAQQEANNTGALSEQFVTIGAASLALLVVAAITVLMGMA*
Ga0055488_1001710833300004070Natural And Restored WetlandsPLALNFKSILPADPVAQQEANNTGALSEQFVTIGAASLALLVVAAITVLMGMA*
Ga0062593_10068786523300004114SoilLALNFRTILPAEPVAQTEIKDTRALSEQLVTIAAASLAVLVVAAIALLMGMA*
Ga0062593_10105486213300004114SoilLPLNFRSILPADSVAQQEIDNSGALSDQLVTIGAASLALLVVAAIAVLMGMA*
Ga0062593_10108925113300004114SoilLALNFRSLLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAIAVLMGMA*
Ga0062593_10276266523300004114SoilLTLNFRSILPADPVAQQEANNTGALSEQFVTIGAASLALLVVAAIAVLMGMA*
Ga0062589_10196735623300004156SoilLPLNFRSILPADPVAQQEIDNSGALSDQLVTIGAASLALLVVAAIAVLMGMA*
Ga0066817_100717213300005146SoilLALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLIGMA*
Ga0066819_102671723300005148SoilAPLALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0066807_103638423300005161SoilLPADPVAQQEINNTGALSGQFVTIGAASLALLVVAAIAVLMGMA*
Ga0066814_1000490213300005162SoilLPADPVAQQEIDFTGALSEQFVTIGAASLALLVVAAIVVLMGMA*
Ga0066815_1006664023300005164SoilLAFNFRSILPADPVAQQEIDFTGALSEQFVTIGAASLALLVVAAIAVLMGMA*
Ga0066811_102121313300005185SoilFNFRSILPADPVAQQEIDFTGALSEQFVTIGAASLALLVVAAIAVLMGMA*
Ga0068998_1004899013300005213Natural And Restored WetlandsLALNFRSILPADPVAQQAANNTGALSEQFVTIGAASLALLIVAAIAVL
Ga0065712_1001325533300005290Miscanthus RhizosphereLALNFRSLLPANPLAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0065712_1015956713300005290Miscanthus RhizosphereLALNFRSILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA*
Ga0070683_10176912613300005329Corn RhizosphereCLSIQGAPLALNFRSLLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAIAVLMGMA*
Ga0066388_10235591623300005332Tropical Forest SoilLPANPATQQEISDTGALSDQLVTIGAASLALVAVAAIVILVGMA*
Ga0068868_10052004613300005338Miscanthus RhizosphereLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIGMA*
Ga0070668_10152320523300005347Switchgrass RhizosphereRSDAFANRGAPLALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0070681_1136935213300005458Corn RhizosphereLPLNFRSILPADSVAQQEIDNSGALSDQLVTIGAASLALLVVAAIA
Ga0070679_10216134123300005530Corn RhizosphereAPSKRCLCRKGAPLALNFRTILPAEPVAQTEIKDTRALSEQLVTIAAASLAVLVVAAIALLMGMA*
Ga0068853_10214703023300005539Corn RhizosphereRSDAFANRGAPLALNFRSLLPANPLAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0068859_10042386523300005617Switchgrass RhizosphereLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAIAVLMGMA*
Ga0066905_10008845023300005713Tropical Forest SoilLPANPATQQGINDTGALSDQLVTIGAASLALVAVAAIAILMGMA*
Ga0066905_10013116623300005713Tropical Forest SoilLPADPVAGALPDQLVTVGAASLALLVVAAIAILMGMA*
Ga0068861_10157744723300005719Switchgrass RhizosphereDPVAQEVTDTIAPSEQLITIGAASLALLVVVAIAVLMGMA*
Ga0075368_1052086423300006042Populus EndosphereSIQGAPLALNFRSLLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAIAVLMGMA*
Ga0075366_1081614113300006195Populus EndosphereLALNFRSLLPADPVAQQEINDTGELSEQLVTIGAASLALLVVAAIAVLMGLA*
Ga0075422_1026860113300006196Populus RhizosphereRSDAFANRGAPLALNFRSILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA*
Ga0079221_1036147033300006804Agricultural SoilNFRSILPAEPVAQSEIDNAGALSQQLVTIGAASLALLIVAAIAVLMGMA*
Ga0105250_1011170733300009092Switchgrass RhizosphereLPANPVAQQEINNTGALSEQLVMIGAASLALLVVAAIAVLMGMA*
Ga0105247_1051333723300009101Switchgrass RhizosphereLPANPLAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0111538_1006594823300009156Populus RhizosphereMPLQKKGAPLALNFRSLLPADPVAQQEINDTGELSEQLVTIGAASLALLVVAAIAVLMGLA*
Ga0105241_1063593233300009174Corn RhizosphereGAPLALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0105241_1079083413300009174Corn RhizosphereNFRSLLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAIAVLMGMA*
Ga0105238_1298712013300009551Corn RhizosphereEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0126384_1179102023300010046Tropical Forest SoilAPSKRCLKKGAPLALNLRSILPADPVAGALPDQLVTVGAASLALLVVAAIAILMGMA*
Ga0126384_1190780613300010046Tropical Forest SoilMPLQKGAPLAFDFRSFLPADPVVHQEINDAGALSDQLVTIGAASLALVIVAAIAILMGMA
Ga0126382_1226615713300010047Tropical Forest SoilLPADPVAQQDINNSSALSEQLVTIGAASLALLVVA
Ga0126382_1250195313300010047Tropical Forest SoilLPANPATQQEISDTGALSDQLVTIGAASLALVAVAAIAILM
Ga0126377_1005249433300010362Tropical Forest SoilLAFDFRSILSADPVVRQEINDTGALSDQLVTIGAASLALLVVAAIAILMGMA*
Ga0134127_1003699013300010399Terrestrial SoilDPVAQQEANNTGALSEQFVTIGAASLALLVVAAIAVLMGMA*
Ga0134122_1061914833300010400Terrestrial SoilLPADPVAQQEANNTGPLSEQFVTIGAASLALLVVGAIAVLMGMA*
Ga0157336_102489913300012477Arabidopsis RhizosphereEAMPLQIGGAALALNFRSLLPANPVAQQEINNTGALSEQLVMIGAASLALLVVAAIAVLMGMA*
Ga0157346_100246323300012480Arabidopsis RhizosphereMPLQWGAPLALNFRSILPADPVAQQEANNTGALSEQVVTIGAASLALLVVAAIAVLMGMA
Ga0157300_110746013300012884SoilLPANPLAQQEINSTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0157299_1000426943300012899SoilPLALNFRSILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA*
Ga0157299_1003948223300012899SoilVAPLALNFRSLLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAIAVLMGMA*
Ga0157282_1000013413300012904SoilNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIGMA*
Ga0157290_1018672013300012909SoilLPADPVAQTEIKDTGALSEQAVTIAAASLAMLVVAAIAVLMGMA*
Ga0157302_1048670413300012915SoilPLALNFRSLLPANPLAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0157310_1000781923300012916SoilMPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIGMA*
Ga0164241_1121576923300012943SoilMPLQERGAPLALNFRSILPADPVAQTEIKDTGALSEQLVMMAAASLAVLVVAAIAVLMGMA*
Ga0164300_1003070513300012951SoilILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA*
Ga0164299_10000144183300012958SoilFANRGAPLALNFRSILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA*
Ga0157371_1018782833300013102Corn RhizosphereFRSILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA*
Ga0157369_1113721823300013105Corn RhizosphereLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAI
Ga0157369_1195576313300013105Corn RhizosphereLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMG
Ga0075303_107920913300014299Natural And Restored WetlandsLALNFKSILPADPVVQQEANNTGALSEQFVTIGAASLALLVVAAIAVLMGMA*
Ga0075352_101773423300014324Natural And Restored WetlandsLPADPVAQQAANNTGALSEQFVTIGAASLALLIVAAIAVLMGMA*
Ga0157377_1170254913300014745Miscanthus RhizosphereTLNFRSILSADPVARQELNNSGALSEQFVTIGAASLALLVVAAIAVLMGMA*
Ga0132258_1018689313300015371Arabidopsis RhizosphereLPADPVAQQEVTDTTTPSEQLITIGAASLALLVVVAIAVLMGMA*
Ga0132258_1322155223300015371Arabidopsis RhizosphereLPVDPVAEQEINNTGALSEQFVTIGAASLALLIVAAIAVLIGMA*
Ga0132258_1337454713300015371Arabidopsis RhizosphereLPADPVAQQEANNTGPLSEQFVTIGAASLALLVVAAIAVLMGMA*
Ga0132256_10018930813300015372Arabidopsis RhizosphereLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVL
Ga0132256_10035006813300015372Arabidopsis RhizosphereLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA*
Ga0132257_10158896413300015373Arabidopsis RhizosphereLPADPVAQQEIDFTGALSEQFVTIGAASLALLVVAAIAVLMGMA*
Ga0173481_1000133333300019356SoilLPANPLAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0173482_1000004323300019361SoilLALNFRSILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0173482_1007899633300019361SoilLALNFRTILPAEPVAQTEIKDTRALSEQLVTIAAASLAVLVVAAIALLMGMA
Ga0173479_10000355113300019362SoilLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0247786_109405513300022883SoilLALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0247746_100077573300022886SoilLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0247746_106371823300022886SoilLALNFRSLLPANPLAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0247795_106091013300022899SoilSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0247802_1000059103300023077SoilRSDAFANRGAPLALNFRSILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0247748_100102333300023168SoilLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLI
Ga0247796_100512513300023261SoilEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0207423_101372733300025535Natural And Restored WetlandsLALNFKSILPADPVAQQEANNTGALSEQFVTIGAASLALLVVAAITVLMGMA
Ga0207710_1068982513300025900Switchgrass RhizosphereLALNFRSLLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAIAVLMGMA
Ga0207645_1000122513300025907Miscanthus RhizosphereAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0207645_1007801443300025907Miscanthus RhizosphereLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAV
Ga0207684_1133428823300025910Corn, Switchgrass And Miscanthus RhizosphereLPLNFRSILPADPVAQQEIDNSGALSDQLVTIGAASLALLVVAAIAVLMGMA
Ga0207671_1030242343300025914Corn RhizosphereLALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLM
Ga0207660_1102139723300025917Corn RhizosphereQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0207662_1048427023300025918Switchgrass RhizosphereLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAIAVLMGMA
Ga0207649_1118035723300025920Corn RhizosphereLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAIDVLMGMA
Ga0207649_1130766213300025920Corn RhizosphereLALNFRSLLPANPLAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLM
Ga0207652_1173676323300025921Corn RhizosphereAPSKRCLCRKGAPLALNFRTILPAEPVAQTEIKDTRALSEQLVTIAAASLAVLVVAAIALLMGMA
Ga0207659_1118717923300025926Miscanthus RhizosphereAFANRGAPLALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0207701_1029872643300025930Corn, Switchgrass And Miscanthus RhizosphereLPADPVAQQEANNTGALSEQFVTIGAASLALLVVAAIAVLMGMA
Ga0207669_10000470233300025937Miscanthus RhizospherePLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0210078_102818023300025979Natural And Restored WetlandsLPADPVAQQAANNTGALSEQFVTIGAASLALLIVAAIAVLMGMA
Ga0207703_1125593433300026035Switchgrass RhizosphereLALNFRSLLPANPVAQQEINNTGALSEQLVTIGAASLA
Ga0207702_1239115613300026078Corn RhizosphereNFRSILSADPVARQELNNSGALSEQFVTIGAASLALLVVAAIAVLMGMA
Ga0207641_1001100113300026088Switchgrass RhizosphereIGGAPLALNFRSILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0207676_1114716413300026095Switchgrass RhizosphereLALNFRSLLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAI
Ga0256821_102485913300026452SedimentAQQKANNTGALSEHFVTIGAASLALLVVAVIAVLMGMA
Ga0207527_10297713300026759SoilLALNFRSILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIG
Ga0207521_10110343300026940SoilLALNFRSLLPANPLAQQEINNTGALSEQLVTIGAASL
Ga0208761_100050513300026995SoilLPADPVVQQEITNTGALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0207540_10076933300027385SoilEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0207463_10063133300027397SoilALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0207609_10041633300027403SoilHRRSDAFANRGAPLALNFRSILPVDSVAEQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0207618_10034523300027433SoilLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIG
Ga0207553_100127723300027435SoilLALNFRSILPVDSVAEQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0207460_10181913300027482SoilDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0207637_100360123300027483SoilLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLIGMA
Ga0208890_101533433300027523SoilDAFANRGAPLAFNFRSILPADPVAQQEIDFTGALSEQFVTIGAASLALLVVAAIAVLMGM
Ga0209966_106372223300027695Arabidopsis Thaliana RhizosphereLPADPVAEQEIVNSSALSEQLVTICAASLALLVVAAIAALMGMA
Ga0209813_1043461413300027866Populus EndosphereSIQGAPLALNFRSLLPADPVAQEVTDTIAPSEQLITIGAASLALLVVVAIAVLMGMA
Ga0209974_1035246413300027876Arabidopsis Thaliana RhizosphereLALNFRSILPPDPVAQQETNNTGALSEQFVTIGAASLALLVVAAIAVLMGMA
Ga0207428_10009870133300027907Populus RhizosphereAFANRGAPLALNFRSLLPANPVAQQEINNTGALSEQLVMIGAASLALLVVAAIAVLMGMA
Ga0268264_1176415123300028381Switchgrass RhizosphereLPADPVAQEVTDTIAPSAQLITIGAASLALLVVVAIAVLMGMA
(restricted) Ga0255310_1000391713300031197Sandy SoilLPANPVTQQEINNTGALSEQLVTIGAASLALLVVAAIAILMGMA
Ga0307497_1050319713300031226SoilLALNFRSLLPGNPVAQQEINNTGVLSEQLVTIGAASLALLVVAAIAVLMGMA
(restricted) Ga0255312_100721343300031248Sandy SoilLPANPVAQQEINNTGVLSEQLVTIGAASLALLVVAAIAILMGMA
Ga0310887_1018833513300031547SoilVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0310813_1003568073300031716SoilLPAEPVAQQEASNTGALSEQFVTVGAASLALLVVAAIAVLMGMA
Ga0310893_1000753623300031892SoilLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLPLLVVAAIAVLIGMA
Ga0310891_10000397113300031913SoilLLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAIAVLMGMA
Ga0310901_1035521313300031940SoilLPANPVAQQEINNTGALSEQLVMIGAASLALLVVAAIAVLMGMA
Ga0310906_1000669513300032013SoilLPADPVAQQEIDFTGALSEQFVTIGAASLALLVVAAIAVLMGMA
Ga0315910_1082369423300032144SoilLPLNFRSILPADPVAEQEIDNSGALSEQVVTICAASLALLVVAAIAALMGMA
Ga0310889_1004418413300032179SoilLPANPVAQQEINNTGALSEQLVTIGAASLALLVVAAI
Ga0335084_1020050013300033004SoilDPVAQQEANNTGALSEQFVRIGAASLALLVVAAIAVLMGMA
Ga0247830_1157866013300033551SoilSILPVDSVAEQEINNTALSEQFVTIGAASLALLVVAAIAVLIGMA
Ga0373917_0011214_248_3823300034692Sediment SlurryLPADPVAEQEIDNSSALSEQLVTICAASLALLVVAAIAALMGMA
Ga0373950_0033080_819_9623300034818Rhizosphere SoilLALNFRSILPVDSVAEQEINNTGALSEQFVTIGAASLALLVVAAIAVL
Ga0373958_0000032_5935_60933300034819Rhizosphere SoilLALNFRSLLPANPVAQQEINNTGALSEQLVMIGAASLALLVVAAIAVLMGMA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.