Metagenome / Metatranscriptome Family F053835

Basic Information
Family ID	F053835
Family Type	Metagenome / Metatranscriptome
Number of Sequences	140
Average Sequence Length	40 residues
Representative Sequence	SVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE
Number of Associated Samples	87
Number of Associated Scaffolds	140

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	2.14 %
% of genes near scaffold ends (potentially truncated)	36.43 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	87
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.27

Most Common Taxonomy
Group	Unclassified (52.857 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (73.571 % of family members)
Environment Ontology (ENVO)	Unclassified (90.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (82.143 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 15.87% β-sheet: 0.00% Coil/Unstructured: 84.13%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 140 Family Scaffolds
PF13962	PGG	0.71
PF03108	DBD_Tnp_Mut	0.71
PF00098	zf-CCHC	0.71

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
All Organisms	root	All Organisms	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
cellular organisms	root	All Organisms → cellular organisms	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	47.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	45.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	45.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	45.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	45.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	44.29 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	44.29 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	37.86 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	2.14 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.71 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	52.86 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	37.86 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	2.14 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.71 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.71 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005467\|Ga0070706_101689914	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	577	Open in IMG/M
3300005841\|Ga0068863_102293340	Not Available	550	Open in IMG/M
3300005842\|Ga0068858_101559136	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	652	Open in IMG/M
3300007004\|Ga0079218_12938948	Not Available	573	Open in IMG/M
3300009553\|Ga0105249_13203569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	526	Open in IMG/M
3300009972\|Ga0105137_106545	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	593	Open in IMG/M
3300009972\|Ga0105137_110912	Not Available	503	Open in IMG/M
3300009973\|Ga0105136_110805	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	560	Open in IMG/M
3300009975\|Ga0105129_108920	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	653	Open in IMG/M
3300009975\|Ga0105129_109691	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	639	Open in IMG/M
3300009980\|Ga0105135_107209	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	785	Open in IMG/M
3300009980\|Ga0105135_110943	Not Available	699	Open in IMG/M
3300009980\|Ga0105135_111334	Not Available	692	Open in IMG/M
3300009981\|Ga0105133_111554	Not Available	681	Open in IMG/M
3300009984\|Ga0105029_117910	Not Available	581	Open in IMG/M
3300009990\|Ga0105132_130041	Not Available	579	Open in IMG/M
3300009990\|Ga0105132_140021	Not Available	526	Open in IMG/M
3300009992\|Ga0105120_1028725	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	651	Open in IMG/M
3300009994\|Ga0105126_1016503	Not Available	766	Open in IMG/M
3300009994\|Ga0105126_1046638	Not Available	543	Open in IMG/M
3300009994\|Ga0105126_1046750	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	542	Open in IMG/M
3300010371\|Ga0134125_11497614	Not Available	735	Open in IMG/M
3300010371\|Ga0134125_11702250	Not Available	686	Open in IMG/M
3300010396\|Ga0134126_11659062	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	702	Open in IMG/M
3300010397\|Ga0134124_11970573	Not Available	621	Open in IMG/M
3300010397\|Ga0134124_12549213	Not Available	554	Open in IMG/M
3300010401\|Ga0134121_11218281	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	753	Open in IMG/M
3300010403\|Ga0134123_13345497	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	518	Open in IMG/M
3300015270\|Ga0182183_1025918	Not Available	750	Open in IMG/M
3300015278\|Ga0182099_1021680	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	706	Open in IMG/M
3300015278\|Ga0182099_1027707	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	661	Open in IMG/M
3300015284\|Ga0182101_1037862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	697	Open in IMG/M
3300015284\|Ga0182101_1061519	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	596	Open in IMG/M
3300015284\|Ga0182101_1070515	Not Available	569	Open in IMG/M
3300015284\|Ga0182101_1074133	Not Available	560	Open in IMG/M
3300015290\|Ga0182105_1023404	Not Available	833	Open in IMG/M
3300015290\|Ga0182105_1071415	Not Available	584	Open in IMG/M
3300015293\|Ga0182103_1071844	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	570	Open in IMG/M
3300015297\|Ga0182104_1055130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	664	Open in IMG/M
3300015297\|Ga0182104_1090894	Not Available	558	Open in IMG/M
3300015301\|Ga0182184_1024911	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	801	Open in IMG/M
3300015301\|Ga0182184_1077197	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	553	Open in IMG/M
3300015309\|Ga0182098_1078148	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	600	Open in IMG/M
3300015311\|Ga0182182_1100701	Not Available	540	Open in IMG/M
3300015312\|Ga0182168_1043850	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	767	Open in IMG/M
3300015312\|Ga0182168_1062393	Not Available	679	Open in IMG/M
3300015312\|Ga0182168_1131116	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	512	Open in IMG/M
3300015313\|Ga0182164_1007350	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1322	Open in IMG/M
3300015313\|Ga0182164_1112335	Not Available	545	Open in IMG/M
3300015315\|Ga0182120_1027092	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	904	Open in IMG/M
3300015315\|Ga0182120_1058945	Not Available	697	Open in IMG/M
3300015316\|Ga0182121_1066231	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	691	Open in IMG/M
3300015316\|Ga0182121_1066874	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	688	Open in IMG/M
3300015316\|Ga0182121_1127709	Not Available	532	Open in IMG/M
3300015318\|Ga0182181_1057573	Not Available	640	Open in IMG/M
3300015318\|Ga0182181_1065155	Not Available	614	Open in IMG/M
3300015319\|Ga0182130_1061833	Not Available	672	Open in IMG/M
3300015320\|Ga0182165_1118943	Not Available	549	Open in IMG/M
3300015324\|Ga0182134_1131091	Not Available	528	Open in IMG/M
3300015324\|Ga0182134_1149285	Not Available	501	Open in IMG/M
3300015327\|Ga0182114_1107241	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	598	Open in IMG/M
3300015328\|Ga0182153_1005443	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1461	Open in IMG/M
3300015329\|Ga0182135_1055484	Not Available	743	Open in IMG/M
3300015329\|Ga0182135_1072168	Not Available	677	Open in IMG/M
3300015330\|Ga0182152_1055391	Not Available	745	Open in IMG/M
3300015331\|Ga0182131_1031153	Not Available	908	Open in IMG/M
3300015331\|Ga0182131_1071011	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	685	Open in IMG/M
3300015331\|Ga0182131_1135484	Not Available	533	Open in IMG/M
3300015332\|Ga0182117_1075665	Not Available	706	Open in IMG/M
3300015332\|Ga0182117_1118355	Not Available	588	Open in IMG/M
3300015333\|Ga0182147_1144357	Not Available	538	Open in IMG/M
3300015334\|Ga0182132_1033431	Not Available	933	Open in IMG/M
3300015334\|Ga0182132_1068856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	724	Open in IMG/M
3300015336\|Ga0182150_1081519	Not Available	667	Open in IMG/M
3300015336\|Ga0182150_1118687	Not Available	578	Open in IMG/M
3300015336\|Ga0182150_1140548	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	539	Open in IMG/M
3300015337\|Ga0182151_1133260	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	551	Open in IMG/M
3300015337\|Ga0182151_1161306	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	509	Open in IMG/M
3300015338\|Ga0182137_1102689	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	640	Open in IMG/M
3300015340\|Ga0182133_1142186	Not Available	574	Open in IMG/M
3300015340\|Ga0182133_1188467	Not Available	506	Open in IMG/M
3300015348\|Ga0182115_1092013	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	946	Open in IMG/M
3300015348\|Ga0182115_1154678	Not Available	734	Open in IMG/M
3300015349\|Ga0182185_1244960	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	545	Open in IMG/M
3300015349\|Ga0182185_1261984	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	527	Open in IMG/M
3300015350\|Ga0182163_1256825	Not Available	547	Open in IMG/M
3300015352\|Ga0182169_1097293	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	939	Open in IMG/M
3300015352\|Ga0182169_1120739	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	847	Open in IMG/M
3300015352\|Ga0182169_1260298	Not Available	563	Open in IMG/M
3300015353\|Ga0182179_1137207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	756	Open in IMG/M
3300015354\|Ga0182167_1207465	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	715	Open in IMG/M
3300015354\|Ga0182167_1229119	Not Available	674	Open in IMG/M
3300015354\|Ga0182167_1258112	Not Available	627	Open in IMG/M
3300015354\|Ga0182167_1271567	Not Available	607	Open in IMG/M
3300015354\|Ga0182167_1334627	Not Available	531	Open in IMG/M
3300015354\|Ga0182167_1354688	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	512	Open in IMG/M
3300015354\|Ga0182167_1359318	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	508	Open in IMG/M
3300017412\|Ga0182199_1119942	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	621	Open in IMG/M
3300017414\|Ga0182195_1023366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1137	Open in IMG/M
3300017414\|Ga0182195_1106657	Not Available	674	Open in IMG/M
3300017414\|Ga0182195_1122451	Not Available	640	Open in IMG/M
3300017414\|Ga0182195_1180440	Not Available	548	Open in IMG/M
3300017421\|Ga0182213_1090767	Not Available	845	Open in IMG/M
3300017421\|Ga0182213_1199132	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	570	Open in IMG/M
3300017422\|Ga0182201_1134576	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	516	Open in IMG/M
3300017432\|Ga0182196_1037556	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	817	Open in IMG/M
3300017432\|Ga0182196_1102277	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	584	Open in IMG/M
3300017432\|Ga0182196_1113438	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	563	Open in IMG/M
3300017432\|Ga0182196_1129186	Not Available	538	Open in IMG/M
3300017435\|Ga0182194_1145316	Not Available	515	Open in IMG/M
3300017440\|Ga0182214_1138023	Not Available	537	Open in IMG/M
3300017445\|Ga0182198_1104507	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	651	Open in IMG/M
3300017445\|Ga0182198_1133642	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	593	Open in IMG/M
3300017445\|Ga0182198_1151655	Not Available	565	Open in IMG/M
3300017447\|Ga0182215_1166467	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	513	Open in IMG/M
3300017691\|Ga0182212_1149978	Not Available	531	Open in IMG/M
3300017692\|Ga0182210_1127439	Not Available	558	Open in IMG/M
3300017693\|Ga0182216_1039868	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	969	Open in IMG/M
3300017694\|Ga0182211_1052311	Not Available	937	Open in IMG/M
3300020023\|Ga0182178_1022516	Not Available	508	Open in IMG/M
3300028051\|Ga0268344_1025065	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	512	Open in IMG/M
3300028053\|Ga0268346_1016130	Not Available	692	Open in IMG/M
3300028056\|Ga0268330_1045930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	564	Open in IMG/M
3300028058\|Ga0268332_1073608	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	517	Open in IMG/M
3300028061\|Ga0268314_1040896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	558	Open in IMG/M
3300028139\|Ga0268355_1019467	Not Available	500	Open in IMG/M
3300028149\|Ga0268353_119755	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	507	Open in IMG/M
3300028379\|Ga0268266_12199310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	524	Open in IMG/M
3300028381\|Ga0268264_10931178	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	873	Open in IMG/M
3300032465\|Ga0214493_1090419	Not Available	728	Open in IMG/M
3300032467\|Ga0214488_1122819	Not Available	550	Open in IMG/M
3300032469\|Ga0214491_1089847	Not Available	740	Open in IMG/M
3300032551\|Ga0321339_1138847	Not Available	539	Open in IMG/M
3300032760\|Ga0314754_1049901	Not Available	657	Open in IMG/M
3300032760\|Ga0314754_1068884	Not Available	548	Open in IMG/M
3300032761\|Ga0314733_1098173	Not Available	550	Open in IMG/M
3300032915\|Ga0314749_1044277	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	954	Open in IMG/M
3300032916\|Ga0314734_1071431	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	697	Open in IMG/M
3300033526\|Ga0314761_1086583	Not Available	696	Open in IMG/M
3300033538\|Ga0314755_1149085	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	595	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	93.57%
Environmental	Environmental	6.43%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	93.57%
Terrestrial	Environmental → Terrestrial	6.43%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	78.57%
Unclassified	Host-Associated → Plants → Unclassified	10.71%
Soil	Environmental → Terrestrial → Soil	6.43%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.14%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.14%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	78.57%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	10.71%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	5.71%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.43%
Loam	Environmental → Terrestrial → Soil → Loam	0.71%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	78.57%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	10.71%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	5.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.43%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.71%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.71%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	73.57%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	10.71%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	5.00%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	5.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.14%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.43%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.71%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.71%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated	Open in IMG/M
3300009973	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG	Host-Associated	Open in IMG/M
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009984	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028149	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032760	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032915	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032916	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033538	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.27
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.27
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F053835

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070706_1016899141	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	VHISDTPSVDGLGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0068863_1022933401	3300005841	Switchgrass Rhizosphere	VDGVGLVEYFYTHPIYICGFSSKEDPDFVVEDVE*
Ga0068858_1015591361	3300005842	Switchgrass Rhizosphere	RISVLPPSVDGVGLVEYFYTHPIYLCGFSPEEDPDFVVEDVE*
Ga0079218_129389481	3300007004	Agricultural Soil	LCIILIVSPSMDGVGLVEYFCTHPCFVAPDEDPDFIAEDFK*
Ga0105249_132035691	3300009553	Switchgrass Rhizosphere	VLSSSVDGVGLVEYFCTHPIYICGFSPEEDPDFAVEDVE*
Ga0105137_1065451	3300009972	Switchgrass Associated	VLSPSVDVVGLVEYFCTHPIYICGFSSEENPDYAVEDVE*
Ga0105137_1109122	3300009972	Switchgrass Associated	VDGVGLVEYFYTHPIYICGFAPEEDPDFVVEDVE*
Ga0105136_1108051	3300009973	Switchgrass Associated	SLVYPVHICVTPSVDGVGLIEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0105129_1089201	3300009975	Switchgrass Associated	VIPPSVDGVGLVEYFYTHPIYICGFSSEEDPDFVVEDVE*
Ga0105129_1096912	3300009975	Switchgrass Associated	VTPFVDGVVLVEYFRTQPIYICGFSSEEDPDFVIEDVE*
Ga0105135_1072091	3300009980	Switchgrass Associated	LIYPVDICDTPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0105135_1109431	3300009980	Switchgrass Associated	VDGVGLVEYFFTHPIYICGFSSEEDPDFVVEDVE*
Ga0105135_1113341	3300009980	Switchgrass Associated	LVYPVHICDTPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0105133_1115541	3300009981	Switchgrass Associated	VHICVTPSVDGVELVEYFRTHPIYICGFSSEEDPDFVIEDVE*
Ga0105029_1179101	3300009984	Switchgrass Rhizosphere	VHICDTPFVDGVGLVEYFCTHLIYICGFSSEEDPDFVVEDVE*
Ga0105132_1300411	3300009990	Switchgrass Associated	MYSVLSPSVDGVGLVEYFRTHPIYICGFSSEENPDFVPEDVE*
Ga0105132_1400212	3300009990	Switchgrass Associated	MHICDTPSVDGVGLVEYFCTHPIYICGFSSEEDPNFVVEDIE*
Ga0105120_10287251	3300009992	Switchgrass Associated	VIPPSVDGVGLVEYFCTHPIFICGFASEEDPDFVVEDVE*
Ga0105126_10165031	3300009994	Switchgrass Associated	MNSPSVDGVGLVEYFCTHPDIYVVASEEDPDFVVEDVE*
Ga0105126_10466381	3300009994	Switchgrass Associated	VLSPSMDGVGLVEYFCTHPIYICGFASEEDPDFVAEDVE*
Ga0105126_10467501	3300009994	Switchgrass Associated	VHIYVTPFVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0134125_114976142	3300010371	Terrestrial Soil	VHICDTPSVDGVGLVEYFSTHPIYICGFSSEEDPDFVVEDVE*
Ga0134125_117022501	3300010371	Terrestrial Soil	MLSPTVDGVQLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0134126_116590622	3300010396	Terrestrial Soil	FVLSPSVDGIGLVEYFCTHPIYICGFSSEEDSDFAVEDVE*
Ga0134124_119705731	3300010397	Terrestrial Soil	VDGVGLVEYFCTHPIYIFGFSSEEDPDFMFEDVE*
Ga0134124_125492131	3300010397	Terrestrial Soil	VDGVGLVEYFCTHPIYISGFASEEDPDFVVEDVE*
Ga0134121_112182812	3300010401	Terrestrial Soil	VLSLSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0134123_133454971	3300010403	Terrestrial Soil	TPSVDGVGLVEYFCTHPIYICGFSPEEDPDFVVEDVE*
Ga0182183_10259181	3300015270	Switchgrass Phyllosphere	VHICDTPFVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0182099_10216801	3300015278	Switchgrass Phyllosphere	VLSPSVDGVGLVEYFCTHPIYICGFSSEEDPDFAVEDVE*
Ga0182099_10277071	3300015278	Switchgrass Phyllosphere	VIPPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0182101_10378621	3300015284	Switchgrass Phyllosphere	VLSPSVDGVELVEYFCTHPIYICGFSPEEDPDFAVEDVE*
Ga0182101_10615191	3300015284	Switchgrass Phyllosphere	MDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0182101_10705151	3300015284	Switchgrass Phyllosphere	VDGVGLVEYFCTHPIYICGFSLEEDPDFVVEDVE*
Ga0182101_10741331	3300015284	Switchgrass Phyllosphere	VDGVGLVEYFCTHPIYICGFASEEDPDFVVEDVE*
Ga0182105_10234041	3300015290	Switchgrass Phyllosphere	VIPPSVDGVGLVEYFCTHPINICGFSSEEDPDFVVE
Ga0182105_10714151	3300015290	Switchgrass Phyllosphere	LIYSVHICDTPSVDGVGLVDYFCTHPLYICGFASEEDSDFVPK
Ga0182103_10718441	3300015293	Switchgrass Phyllosphere	ILCISVIPPSVDGVGLVEYFCTHPVYICGFSSEEDPDYAVEDIE*
Ga0182104_10551301	3300015297	Switchgrass Phyllosphere	MHICDTPSVDGVGLVEYFCTHPIYICGFSSEKDSDFVVEDVV*
Ga0182104_10908941	3300015297	Switchgrass Phyllosphere	MNSPSMDGVGLVEYFCTHLIYICGFSSEEDPDFVVEDVE*
Ga0182184_10249111	3300015301	Switchgrass Phyllosphere	MYSVLSPSVGGVGLVEYFRTHPIYIYGFSSEEDPDFVPEDVE*
Ga0182184_10771971	3300015301	Switchgrass Phyllosphere	MNSPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0182098_10781481	3300015309	Switchgrass Phyllosphere	VIPPSVDGVGLVEYFCTHPIYICGFSPEEDPDFVVEDVE*
Ga0182182_11007011	3300015311	Switchgrass Phyllosphere	LIYPAHIWVTPSVDVVGLVEYFCTHPIYICGFSSEEDLDFVVEDVE*
Ga0182168_10438501	3300015312	Switchgrass Phyllosphere	CVTPSVDGVGLVEFFCTHPIYICSLSSEEDPDFIVEDIE*
Ga0182168_10623931	3300015312	Switchgrass Phyllosphere	VDGVELVEYFCTHPIYICGFSPEEDPDFIVEDVE*
Ga0182168_11311161	3300015312	Switchgrass Phyllosphere	VIPPSVDGVGLVEYFCTHPIYIYGFSSEEDPDFVVEDVE*
Ga0182164_10073501	3300015313	Switchgrass Phyllosphere	VLSPSVDGVGLVEYFCTHPIYMCGFSSEEDADFAVEDVE*
Ga0182164_11123351	3300015313	Switchgrass Phyllosphere	MDVVGLVEYFYTHPIYICGFSSEEDSDFVVEDVE*
Ga0182120_10270921	3300015315	Switchgrass Phyllosphere	VIPPSVDGVGLVEYFCTHPIYICGFSSEEDLDFVVEDVE*
Ga0182120_10589451	3300015315	Switchgrass Phyllosphere	MHICDTPSVDGVGLVEYFCTYPIYICGFSSEEDLNFVVEDVE*
Ga0182121_10662311	3300015316	Switchgrass Phyllosphere	SPSVDGVGLVEYFCTHPIYICDFSSEEDPDFTVEDVE*
Ga0182121_10668741	3300015316	Switchgrass Phyllosphere	MYSVLSPSVGGVGFVEYFCTHPIYICGFASEEDPD
Ga0182121_11277091	3300015316	Switchgrass Phyllosphere	VHICDTPSVDGVELVEYFCTHPIYICGFSPEEDPDFVVEDVE*
Ga0182181_10575731	3300015318	Switchgrass Phyllosphere	MHICVTPSVGGVGLVEYFCTHPIYICGFSSEEDPDFAVEDVE*
Ga0182181_10651551	3300015318	Switchgrass Phyllosphere	MDGVGLVEYFYTHPINICGFSLEEDPDFVVEDVE*
Ga0182130_10618331	3300015319	Switchgrass Phyllosphere	MYSVLSPSVGGVGLVEYFRTHPIYICGFSSEEDPDFVPEDVE*
Ga0182165_11189431	3300015320	Switchgrass Phyllosphere	MYISVIPPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0182134_11310912	3300015324	Switchgrass Phyllosphere	VLSPSVDGVGIVEYLYTHPIYICDFSSEEDPDFAVEDVE*
Ga0182134_11492852	3300015324	Switchgrass Phyllosphere	VLSPSVAGIGLVEYFCTHPIYICGFASEEDPDFVVEDVE*
Ga0182114_11072411	3300015327	Switchgrass Phyllosphere	IYPEHIYVTPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0182153_10054432	3300015328	Switchgrass Phyllosphere	MHIYDTPSVDGVGVVEYFCTHPIYFCGFSPEEDPDFVVEDVE*
Ga0182135_10554841	3300015329	Switchgrass Phyllosphere	VLSPFVDGVGPAEYFCTHLIYIYDFSSEEDPDFAVEDVE*
Ga0182135_10721682	3300015329	Switchgrass Phyllosphere	VDGVGIVEYLYTHPIYICDFSSEEDPDFAVEDVE*
Ga0182152_10553912	3300015330	Switchgrass Phyllosphere	SVIPPFVDGVGLVEYFCTHSIYICGFSLEDDSDFVVEDVE*
Ga0182131_10311531	3300015331	Switchgrass Phyllosphere	MCISVLSPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0182131_10710112	3300015331	Switchgrass Phyllosphere	VDGVGLVEYFCTHPIYFCGFSPEEDPDFVVEDVM*
Ga0182131_11354841	3300015331	Switchgrass Phyllosphere	VLSPSVDGVGLVEYFCTHPIYICGFASEEDLDFVPEDVE*
Ga0182117_10756651	3300015332	Switchgrass Phyllosphere	MLSPTVDGVQLVEYFCTHPIYICGFSPEEDPDFVEDVE*
Ga0182117_11183551	3300015332	Switchgrass Phyllosphere	MDGVGLVDYFCTHPIYICGFYSEKDPDFAVKDVE*
Ga0182147_11443571	3300015333	Switchgrass Phyllosphere	VDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0182132_10334311	3300015334	Switchgrass Phyllosphere	VDGVGFVEYFCTHLIYICGFSSEEDPDFAVEDVE*
Ga0182132_10688561	3300015334	Switchgrass Phyllosphere	VLSSSVDGVGLVEYFCTHPIFICGFVSEEDPDFVVEDIE*
Ga0182150_10815191	3300015336	Switchgrass Phyllosphere	VLSPSVDGVELVEYFCTNPIYICGFSSEEDPDFVVEDVE*
Ga0182150_11186871	3300015336	Switchgrass Phyllosphere	LIYPVHICVTPSVDGVGLVEYFCTHPIYICGFSSEEDPD
Ga0182150_11405481	3300015336	Switchgrass Phyllosphere	PAHIYVTPSVDGVGLIEYFCTHPIYIYDFSSEEDPDFAVEDVE*
Ga0182151_11332601	3300015337	Switchgrass Phyllosphere	SPSVDGFRLVEYFCTHPIYICGFSSEEDPDFAVEYVE*
Ga0182151_11613061	3300015337	Switchgrass Phyllosphere	SVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE*
Ga0182137_11026891	3300015338	Switchgrass Phyllosphere	VIPPFVDGVGLVEYFCTHPIYICGFSSEEDPDFVAEDVE*
Ga0182133_11421862	3300015340	Switchgrass Phyllosphere	VHILGLSPSADEVGLVEYFCTHPDIHVVALEEDPDFVVEDLE*
Ga0182133_11884671	3300015340	Switchgrass Phyllosphere	VDGAGLVEYFYTHPIYLCGFSPEEDPDFVVEDVE*
Ga0182115_10920131	3300015348	Switchgrass Phyllosphere	LVYPVHICDTPSVDGVGLVEYFCTHPIYICGFSSEEDPDFAVEDVE*
Ga0182115_11546781	3300015348	Switchgrass Phyllosphere	MYSVLSPSVGGVGFVEYFCTHPIYIYGFASEEDPDFVPEDVE*
Ga0182185_12449601	3300015349	Switchgrass Phyllosphere	MDGVGLVEYFCTHPIYFCGFSPKEDPDFVVEDVE*
Ga0182185_12619841	3300015349	Switchgrass Phyllosphere	MNSPSMDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE
Ga0182163_12568252	3300015350	Switchgrass Phyllosphere	PVHICVTLSVNGVGLVEYFCTHPLYIYGFTSEEDPDFVPEGVE*
Ga0182169_10972931	3300015352	Switchgrass Phyllosphere	MDGVGLVEYFCTHPIYICGFSQEEDPDFVVEDVE*
Ga0182169_11207392	3300015352	Switchgrass Phyllosphere	ILCISVLSPSVDGVGLVEYFCTHPIYICGFSSEEDPDFAVEDVE*
Ga0182169_12602981	3300015352	Switchgrass Phyllosphere	VHICVTLSVDGVVLVEYFCTHPINICGFSLEEDPDFVVEDVE*
Ga0182179_11372071	3300015353	Switchgrass Phyllosphere	MDGVGLVEYFCTHPIYICGFSPEEDPDFAVEDVE*
Ga0182167_12074652	3300015354	Switchgrass Phyllosphere	DTPSVDGVGLVEYFCTHPIYICGFSSEEDPNFVVEDIE*
Ga0182167_12291192	3300015354	Switchgrass Phyllosphere	VLSPSVDGVGLVEYFCTHLINICGFSLEEDPDFVVEDVE*
Ga0182167_12581121	3300015354	Switchgrass Phyllosphere	VLSLSVDVVGLVEYFCTHPIYICGFSSEEDPDFAVEDVE*
Ga0182167_12715672	3300015354	Switchgrass Phyllosphere	MHIYDTPSVDGVGVVEYFCTLPIFICGFTSEEDSDFVVEDVE*
Ga0182167_13346271	3300015354	Switchgrass Phyllosphere	MCIFELPLSVDGVGLVEYFCTHPIYIFGFSSEEDPDFMFEDVE*
Ga0182167_13546881	3300015354	Switchgrass Phyllosphere	VNGVGLVEYFCTHPLYIYGFTSEEDPDFVPEGVE*
Ga0182167_13593182	3300015354	Switchgrass Phyllosphere	MDGVGLVEYFCTHPIYICGFSSEEDPDFAIEDVE*
Ga0182199_11199422	3300017412	Switchgrass Phyllosphere	ILCISVLSPSVDGVGLVEYFCTHSIFICGFASEEDPDFVVEDVK
Ga0182195_10233661	3300017414	Switchgrass Phyllosphere	SPSVDGVGLVEYFCTHPLYICGFSSEEDPDFVVEDVE
Ga0182195_11066571	3300017414	Switchgrass Phyllosphere	LVYPVHICDTPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE
Ga0182195_11224512	3300017414	Switchgrass Phyllosphere	VTPFVDGVVLVEYFRTQPIYICGFSSEEDPDFVIEDVE
Ga0182195_11804401	3300017414	Switchgrass Phyllosphere	VHICVIPSVDGVGLVEYFYTHPIYICGFASEEDPDFVVEDVE
Ga0182213_10907671	3300017421	Switchgrass Phyllosphere	VHIYVTPFVDGVGLVEYFCTHPIYICGFASEEDPDFVLEDVE
Ga0182213_11991322	3300017421	Switchgrass Phyllosphere	CDTLFVDGVGLVEYFCTHPIYICGFFSEEDPDFVVEDVE
Ga0182201_11345761	3300017422	Switchgrass Phyllosphere	MNSPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE
Ga0182196_10375561	3300017432	Switchgrass Phyllosphere	TSDLSLIYSVHICDTPSMDGVGLVEYFYTHPIYICGFSSEEDPNFVVEDIE
Ga0182196_11022771	3300017432	Switchgrass Phyllosphere	PVHSCYIPSVGGVELVEYICTHPLFICGFSSEEDPDYTIEDAE
Ga0182196_11134381	3300017432	Switchgrass Phyllosphere	VHIYVTPSVDGVGLVEYLCTHPIYLCGFSPKEDPDFVIEDIE
Ga0182196_11291861	3300017432	Switchgrass Phyllosphere	VHICDTPSVDGVGLVEYSCTHPIYICGFSSEEDLDFVVEDVE
Ga0182194_11453161	3300017435	Switchgrass Phyllosphere	IMCIYSVYTPSVGVVELVEYFCTHPDIYVVASEEDSDFVVEDVE
Ga0182214_11380231	3300017440	Switchgrass Phyllosphere	VIPPSVDGVGLVEYFYTHPIYICGFSSEEDPDFIVED
Ga0182198_11045071	3300017445	Switchgrass Phyllosphere	VLSPSVDGVGLVEYFCTHPIYICGFSSEEDPDFAVEDVE
Ga0182198_11336421	3300017445	Switchgrass Phyllosphere	MLPPSVDVVGLVEYFCTRPIYICGFSPEEDPDFVVEDVE
Ga0182198_11516551	3300017445	Switchgrass Phyllosphere	VIPPSVDGVGLVEYFCTHPYFVTSEEDPDFVVEDVE
Ga0182215_11664671	3300017447	Switchgrass Phyllosphere	LCYSPSVDGVGLVEYFCTHPIYICGFSSEEDPDFAVEDVE
Ga0182212_11499781	3300017691	Switchgrass Phyllosphere	VHICVTPSVDGVGLVEYFCTHPIYIYGFSLEEDPDFVVEDIE
Ga0182210_11274392	3300017692	Switchgrass Phyllosphere	VLSPSVDGVGLVEYFCTHPINICGFSLEEDANFAVEDVE
Ga0182216_10398681	3300017693	Switchgrass Phyllosphere	IYPVHICVTPSVDGVGLVEYFCTHPLYICGFSSEEDPDFVVEDVE
Ga0182211_10523111	3300017694	Switchgrass Phyllosphere	LIYPAHICVTPSVDGVGLVEYFCTHPIYIFGFSSEEEPDFVVEDVE
Ga0182178_10225161	3300020023	Switchgrass Phyllosphere	TPSVDGVGLVEYSCTHPIYICGFSSEEDLDFVVEDVE
Ga0268344_10250651	3300028051	Phyllosphere	SVDGVGLVEYFCTHPVYICGFSSEEDPDFVVEDVE
Ga0268346_10161301	3300028053	Phyllosphere	LIYPEHICVTPSVDGVGLIEYFCTHPIYICGFSSEEDLDFVV
Ga0268330_10459301	3300028056	Phyllosphere	MHICDTPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE
Ga0268332_10736081	3300028058	Phyllosphere	MIPPSVDGVGLVEYFCTHPIYICGFSSEEDSDFVVEDVE
Ga0268314_10408961	3300028061	Phyllosphere	VLSSSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE
Ga0268355_10194671	3300028139	Phyllosphere	MCISVLSPSVDGVGLVEYFCTHPIYICGFSSEEDPNFAVEDVE
Ga0268353_1197551	3300028149	Phyllosphere	YPMHICDAPSVDGVGLVEYFCTHPIYICDFSSEEDPDFVVEDVE
Ga0268266_121993101	3300028379	Switchgrass Rhizosphere	MHILVVSPSVDGVGLVEYFCTHPCFVASEEDPDFVAEDFE
Ga0268264_109311781	3300028381	Switchgrass Rhizosphere	VLSLSVDVVGLVEYFCTHPIYICGFSSEEDPDFAVEDVE
Ga0214493_10904191	3300032465	Switchgrass Phyllosphere	PCVEEIGLVECFCTHPDIYVVASEEDPDFVVEDVE
Ga0214488_11228191	3300032467	Switchgrass Phyllosphere	PVHICVTPSVGGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE
Ga0214491_10898471	3300032469	Switchgrass Phyllosphere	VHICVTPSVGGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE
Ga0321339_11388471	3300032551	Switchgrass Phyllosphere	LIYPAHICVTPSVDGVGLVEYFYTHPIYICGFLQRKIR
Ga0314754_10499011	3300032760	Switchgrass Phyllosphere	VHICVTPSVGGVGLVECFCTHPIYICGLSSEEDPDFVVEDVE
Ga0314754_10688841	3300032760	Switchgrass Phyllosphere	YPVHICVTPSVDGVGLVEYFCTHPIYLYGFSLEEDPDFVLKDVE
Ga0314733_10981731	3300032761	Switchgrass Phyllosphere	VLSPSVDGVGLVEYFCTYPIYIYGFSSEEDPDFIVEDV
Ga0314749_10442772	3300032915	Switchgrass Phyllosphere	MCISVLSPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE
Ga0314734_10714312	3300032916	Switchgrass Phyllosphere	PSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDIE
Ga0314761_10865832	3300033526	Switchgrass Phyllosphere	MLYIPPVEEVGLVEYFCTHPDIYVVASEEDPDFVVEDIE
Ga0314755_11490851	3300033538	Switchgrass Phyllosphere	VIPPSVDGVGLVEYFCTHPIYICGFSSEEDPDFVVEDVE

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign