NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F055294

Metagenome Family F055294

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055294
Family Type Metagenome
Number of Sequences 139
Average Sequence Length 75 residues
Representative Sequence MPKKKTTVLMEPEAAIPVQVEAPAISEGSIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPTCNESIDWSSLDA
Number of Associated Samples 57
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.77 %
% of genes near scaffold ends (potentially truncated) 20.86 %
% of genes from short scaffolds (< 2000 bps) 77.70 %
Associated GOLD sequencing projects 50
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(52.518 % of family members)
Environment Ontology (ENVO) Unclassified
(96.403 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(68.345 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 5.66%    Coil/Unstructured: 94.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF12728HTH_17 6.47
PF00154RecA 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001392|Lau_10078884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium3057Open in IMG/M
3300001392|Lau_10087566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium6886Open in IMG/M
3300001524|Abe_1074920All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium936Open in IMG/M
3300001743|JGI24515J20084_1001418All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2091Open in IMG/M
3300001743|JGI24515J20084_1008173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium953Open in IMG/M
3300002511|JGI25131J35506_1023800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium843Open in IMG/M
3300002760|JGI25136J39404_1015446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1373Open in IMG/M
3300002760|JGI25136J39404_1022392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus1147Open in IMG/M
3300002760|JGI25136J39404_1022677All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1140Open in IMG/M
3300002760|JGI25136J39404_1023615All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1119Open in IMG/M
3300002760|JGI25136J39404_1026702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1054Open in IMG/M
3300002760|JGI25136J39404_1031630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium970Open in IMG/M
3300002760|JGI25136J39404_1048356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium788Open in IMG/M
3300002760|JGI25136J39404_1059343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium711Open in IMG/M
3300002760|JGI25136J39404_1093394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium565Open in IMG/M
3300003690|PicViral_1001415All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium7051Open in IMG/M
3300004870|Ga0071103_107125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1882Open in IMG/M
3300005753|Ga0077776_1007257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1324Open in IMG/M
3300006753|Ga0098039_1142076All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium822Open in IMG/M
3300006900|Ga0066376_10677905All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium569Open in IMG/M
3300006947|Ga0075444_10363542All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium549Open in IMG/M
3300009173|Ga0114996_10139774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2005Open in IMG/M
3300009173|Ga0114996_10159151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1853Open in IMG/M
3300009173|Ga0114996_10211047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1560Open in IMG/M
3300009173|Ga0114996_10247398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1415Open in IMG/M
3300009173|Ga0114996_10505414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium910Open in IMG/M
3300009173|Ga0114996_10540089All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium874Open in IMG/M
3300009173|Ga0114996_10890205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium638Open in IMG/M
3300009173|Ga0114996_11273804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium512Open in IMG/M
3300009409|Ga0114993_10404741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1025Open in IMG/M
3300009706|Ga0115002_10352014All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1099Open in IMG/M
3300009786|Ga0114999_10127512All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2182Open in IMG/M
3300010883|Ga0133547_10932150All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1689Open in IMG/M
3300017724|Ga0181388_1094613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium711Open in IMG/M
3300017728|Ga0181419_1111451All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium669Open in IMG/M
3300017729|Ga0181396_1115373All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium552Open in IMG/M
3300017731|Ga0181416_1029628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1284Open in IMG/M
3300017744|Ga0181397_1092173All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium801Open in IMG/M
3300017744|Ga0181397_1095895All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium783Open in IMG/M
3300017744|Ga0181397_1112997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium709Open in IMG/M
3300017753|Ga0181407_1136723All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium609Open in IMG/M
3300017757|Ga0181420_1005810All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium4348Open in IMG/M
3300017757|Ga0181420_1008871All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium3453Open in IMG/M
3300017757|Ga0181420_1024780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1984Open in IMG/M
3300017768|Ga0187220_1220755All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium569Open in IMG/M
3300017772|Ga0181430_1014474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2656Open in IMG/M
3300017772|Ga0181430_1133673All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium726Open in IMG/M
3300017772|Ga0181430_1239218All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium513Open in IMG/M
3300017773|Ga0181386_1072317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1091Open in IMG/M
3300017775|Ga0181432_1000627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium7478Open in IMG/M
3300017775|Ga0181432_1008888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus2406Open in IMG/M
3300017775|Ga0181432_1012927All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2066Open in IMG/M
3300017775|Ga0181432_1015038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1942Open in IMG/M
3300017775|Ga0181432_1027984All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1498Open in IMG/M
3300017775|Ga0181432_1042749All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1250Open in IMG/M
3300017775|Ga0181432_1043136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1244Open in IMG/M
3300017775|Ga0181432_1058790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1089Open in IMG/M
3300017775|Ga0181432_1071658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1001Open in IMG/M
3300017775|Ga0181432_1074213All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium986Open in IMG/M
3300017775|Ga0181432_1077919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium965Open in IMG/M
3300017775|Ga0181432_1080499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium951Open in IMG/M
3300017775|Ga0181432_1129430All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium766Open in IMG/M
3300017775|Ga0181432_1148585All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium719Open in IMG/M
3300017775|Ga0181432_1274985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium533Open in IMG/M
3300020398|Ga0211637_10083805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1283Open in IMG/M
3300020444|Ga0211578_10075480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1293Open in IMG/M
3300020458|Ga0211697_10496747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium509Open in IMG/M
3300021977|Ga0232639_1116309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1015Open in IMG/M
3300025042|Ga0207889_1003607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1717Open in IMG/M
3300025050|Ga0207892_1003091All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1680Open in IMG/M
3300025052|Ga0207906_1000872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium7941Open in IMG/M
3300025052|Ga0207906_1038314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium653Open in IMG/M
3300025122|Ga0209434_1064422All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1102Open in IMG/M
3300025122|Ga0209434_1167817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium587Open in IMG/M
3300025125|Ga0209644_1013422All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1731Open in IMG/M
3300025125|Ga0209644_1056935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium900Open in IMG/M
3300025287|Ga0207903_1093917All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium502Open in IMG/M
3300025873|Ga0209757_10016840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1998Open in IMG/M
3300025873|Ga0209757_10019598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus1868Open in IMG/M
3300025873|Ga0209757_10035906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1427Open in IMG/M
3300025873|Ga0209757_10042721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1318Open in IMG/M
3300025873|Ga0209757_10048780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1240Open in IMG/M
3300025873|Ga0209757_10093158All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium917Open in IMG/M
3300025873|Ga0209757_10103973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium871Open in IMG/M
3300025873|Ga0209757_10114087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus833Open in IMG/M
3300025873|Ga0209757_10161068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium705Open in IMG/M
3300025873|Ga0209757_10169751All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium687Open in IMG/M
3300025873|Ga0209757_10190639All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium648Open in IMG/M
3300027838|Ga0209089_10306070All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium904Open in IMG/M
3300027838|Ga0209089_10582292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium592Open in IMG/M
3300027839|Ga0209403_10119647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1696Open in IMG/M
3300027839|Ga0209403_10146693All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1469Open in IMG/M
3300027839|Ga0209403_10216781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1117Open in IMG/M
3300027839|Ga0209403_10479024All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium634Open in IMG/M
3300027844|Ga0209501_10034099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium3817Open in IMG/M
3300027844|Ga0209501_10206890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus1260Open in IMG/M
3300027844|Ga0209501_10286927All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1017Open in IMG/M
3300027844|Ga0209501_10554325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium648Open in IMG/M
3300027847|Ga0209402_10214344All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1248Open in IMG/M
3300027847|Ga0209402_10276008All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1060Open in IMG/M
3300027847|Ga0209402_10545513All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium667Open in IMG/M
3300031605|Ga0302132_10416305All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium603Open in IMG/M
3300031623|Ga0302123_10022354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus3694Open in IMG/M
3300031623|Ga0302123_10037997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2718Open in IMG/M
3300031623|Ga0302123_10055095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus2186Open in IMG/M
3300031623|Ga0302123_10084217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1704Open in IMG/M
3300031623|Ga0302123_10112324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1438Open in IMG/M
3300031623|Ga0302123_10168167All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1123Open in IMG/M
3300031623|Ga0302123_10435380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium599Open in IMG/M
3300031625|Ga0302135_10013656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus4513Open in IMG/M
3300031627|Ga0302118_10100610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus1441Open in IMG/M
3300031627|Ga0302118_10258628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium816Open in IMG/M
3300031646|Ga0302133_10008592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium5966Open in IMG/M
3300031646|Ga0302133_10020386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium3727Open in IMG/M
3300031693|Ga0302139_10276606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium695Open in IMG/M
3300031693|Ga0302139_10282716All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium685Open in IMG/M
3300031800|Ga0310122_10015337All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium4567Open in IMG/M
3300031801|Ga0310121_10009390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium7817Open in IMG/M
3300031801|Ga0310121_10031187All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium3737Open in IMG/M
3300031801|Ga0310121_10284081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium975Open in IMG/M
3300031801|Ga0310121_10451106All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium721Open in IMG/M
3300031802|Ga0310123_10008047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium7706Open in IMG/M
3300031802|Ga0310123_10008253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium7596Open in IMG/M
3300031802|Ga0310123_10023945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium4347Open in IMG/M
3300031802|Ga0310123_10033470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium3652Open in IMG/M
3300031802|Ga0310123_10091215All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2122Open in IMG/M
3300031802|Ga0310123_10102831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1983Open in IMG/M
3300031802|Ga0310123_10118463All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1830Open in IMG/M
3300031802|Ga0310123_10339406All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium980Open in IMG/M
3300031804|Ga0310124_10211675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1190Open in IMG/M
3300032278|Ga0310345_10039020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium4018Open in IMG/M
3300032278|Ga0310345_10087061All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2711Open in IMG/M
3300032278|Ga0310345_10095599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2592Open in IMG/M
3300032278|Ga0310345_10335382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1410Open in IMG/M
3300033742|Ga0314858_140366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium619Open in IMG/M
3300034628|Ga0326755_010501All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium871Open in IMG/M
3300034654|Ga0326741_073694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium565Open in IMG/M
3300034654|Ga0326741_090832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium500Open in IMG/M
3300034656|Ga0326748_009817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1232Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine52.52%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater22.30%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.07%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.88%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.88%
Filtered SeawaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater2.88%
Black Smokers Hydrothermal PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume1.44%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.72%
MarineEnvironmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine0.72%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.72%
Hydrothermal Vent FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids0.72%
Deep-Sea Hydrothermal VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent0.72%
Black Smokers Hydrothermal PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume0.72%
Marine, Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Marine, Hydrothermal Vent Plume0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001392ELSC MetagenomeEnvironmentalOpen in IMG/M
3300001524Abe Hydrothermal PlumeEnvironmentalOpen in IMG/M
3300001743Marine viral communities from the Pacific Ocean - LP-38EnvironmentalOpen in IMG/M
3300002511Marine viral communities from the Pacific Ocean - ETNP_2_1000EnvironmentalOpen in IMG/M
3300002760Marine viral communities from the Pacific Ocean - ETNP_6_1000EnvironmentalOpen in IMG/M
3300003690Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Viral/microbial metagenome assemblyEnvironmentalOpen in IMG/M
3300004870Mid-Atlantic Ridge North Pond Expedition - Sample Bottom Water CTD 2012EnvironmentalOpen in IMG/M
3300005753Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assemblyEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006900Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_AEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300020398Marine microbial communities from Tara Oceans - TARA_B100000949 (ERX555993-ERR599072)EnvironmentalOpen in IMG/M
3300020444Marine microbial communities from Tara Oceans - TARA_B100001245 (ERX556114-ERR598980)EnvironmentalOpen in IMG/M
3300020458Marine microbial communities from Tara Oceans - TARA_B100000749 (ERX556123-ERR599000)EnvironmentalOpen in IMG/M
3300021977Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS925 _150kmerEnvironmentalOpen in IMG/M
3300025042Marine viral communities from the Pacific Ocean - LP-47 (SPAdes)EnvironmentalOpen in IMG/M
3300025050Marine viral communities from the Pacific Ocean - LP-54 (SPAdes)EnvironmentalOpen in IMG/M
3300025052Marine viral communities from the Pacific Ocean - LP-37 (SPAdes)EnvironmentalOpen in IMG/M
3300025122Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes)EnvironmentalOpen in IMG/M
3300025125Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025287Marine viral communities from the Deep Pacific Ocean - MSP-131 (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300027838Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027839Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes)EnvironmentalOpen in IMG/M
3300027844Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300031605Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1EnvironmentalOpen in IMG/M
3300031623Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1EnvironmentalOpen in IMG/M
3300031625Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surfaceEnvironmentalOpen in IMG/M
3300031627Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1EnvironmentalOpen in IMG/M
3300031646Marine microbial communities from Western Arctic Ocean, Canada - CB9_33.1EnvironmentalOpen in IMG/M
3300031693Marine microbial communities from Western Arctic Ocean, Canada - CBN3_33.1EnvironmentalOpen in IMG/M
3300031800Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051EnvironmentalOpen in IMG/M
3300031801Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986EnvironmentalOpen in IMG/M
3300031802Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057EnvironmentalOpen in IMG/M
3300031804Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5EnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034628Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961EnvironmentalOpen in IMG/M
3300034654Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244EnvironmentalOpen in IMG/M
3300034656Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Lau_1007888453300001392Black Smokers Hydrothermal PlumeMVKKKTTVLLEPESGVPVPVVTDGTIGVEYTPPPVGEREEEDTYDCANCQGDLPLRAERCPTCNELINWSSLDN*
Lau_10087566133300001392Black Smokers Hydrothermal PlumeMAKKKTTVLLEPDPGLPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDA*
Abe_107492023300001524Black Smokers Hydrothermal PlumeLPKKKTTVLLEPEPGVPAPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNESINWSSLDN*
JGI24515J20084_100141843300001743MarineMPKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELIDWSSLDN*
JGI24515J20084_100817323300001743MarineMPKKKTTVMLEPETAGPVPVVTEGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELIDWSSLDN*
JGI25131J35506_102380033300002511MarineMVRKSRAKPAQLLEPENVGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNEL
JGI25136J39404_101544653300002760MarineMAKKKTTVLLEPENAGPVPVVTDGTIGVEYTPPPVGEREEADTYDCANCRGDLPLRAERCPTCNESIDWSSLDD*
JGI25136J39404_102239233300002760MarineMAKKKTTVLLEPEPGVPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDN*
JGI25136J39404_102267713300002760MarineMVRKSRAKPAKLLEPEDADPQLPVSDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNE
JGI25136J39404_102361533300002760MarineMAKKKTTVLLEPENAGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDAI*
JGI25136J39404_102670243300002760MarineMVRKSRAKPAQLLEPENAVPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDN*
JGI25136J39404_103163033300002760MarineMPKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELIDWSSLDG*
JGI25136J39404_104835623300002760MarineMAKKKTTVLLEPETGVPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDN*
JGI25136J39404_105934313300002760MarineMVRKSRAKPAQLLEPETIGPVPVVTDGTIGVEYTPPPVGEREEVQTYDCANCQGDLPLRAERCPTCNELINWSSLDAD*
JGI25136J39404_109339423300002760MarineMARKSRAKPAQLLEPENAGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGXLPLRAERCPTC
PicViral_1001415103300003690Marine, Hydrothermal Vent PlumeVPKKKTTKMLEPETGAPSLPVSEGTIGVEYTPPPVGEREETQKYLCANCQGEIELRSPRCQTCNESIDWSSLDA*
Ga0071103_10712543300004870MarineVPKKKTTKMLEPETGAPSLPVSEGTIGVEYTPPPVGEREETQVYLCANCQGEIELRSPRCQTCNESIDWSSLDDN*
Ga0077776_100725713300005753Deep-Sea Hydrothermal VentVPKKKTTKMLEPETGAPSLPVSEGTIGVEYTPPPVGEREETQKYLCANCQGEIELRSPRCQTCNESIDWSSLDD*
Ga0098039_114207633300006753MarineMPKKKTTVLLEPETVDPVPVVTDGTIGVEYTPPPVGERQEVPTYDCANCRGDLPLRAERCPTCNESIDWSSLDG*
Ga0066376_1067790523300006900MarineLPKKKTTKMLEPETGAPLLPVSEGTIGVEYTPPPVGEREEAQKYLCANCQGEIELRSPRCQTCNESIDWSSLDD*
Ga0075444_1036354223300006947MarineLLTYNRGEIMPKKKTVLMEPEAAIPAQVEAPTISEGSIGVEYTPPPVGEREEIQTYDCGNCRADLPLRCERCPICNESIDWSSLDNA*
Ga0114996_1013977453300009173MarineMPKKKTVLMEPDVTTTAQVEAPAISEGSIGVEYSPPPVGEREEEQTYDCANCRGDIPLRCERCPTCNESIDWSSLDG*
Ga0114996_1015915133300009173MarineMPKKKTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQAYDCANCRGEIPLRAERCPTCNESIDWSSLDN*
Ga0114996_1021104743300009173MarineMPKKKTTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCNESIDWSSLDT*
Ga0114996_1024739853300009173MarineMPKKKTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCNESIDWSSLDT*
Ga0114996_1050541433300009173MarineMPKKKTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCNESIDWSSLDN*
Ga0114996_1054008923300009173MarineMPKKKTTVLMEPEAAIPVQLEAPAISEGSIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPICNEPIDWSSLDA*
Ga0114996_1089020513300009173MarineMPKKKTTVLMEPEAAIPVQVEAPAISEGSIGVEYTPPPVGEREEPQTYDCANCRGDLPLRRERCPTCNEPIDWSSLNDNA*
Ga0114996_1127380423300009173MarineMPKKKTTVLMEPEAAIPVQVEAPAISEGSIGVEYTPPPVGDREESQTYDCANCRGDLPLRCERCPTCNESIDWSSLDA*
Ga0114993_1040474113300009409MarineKTVLMEPEAAIPVQVEAPAISEGTIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPICNESIDWSSLDA*
Ga0115002_1035201433300009706MarineRGEIMPKKKTTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCNESIDWSSLDT*
Ga0114999_1012751243300009786MarineMPKKKTVLMEPEAAIPVQVEAPAISEGTIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPICNESIDWSSLDA*
Ga0133547_1093215033300010883MarineMPKKKTVLMEPEAPAMVQVEAPAISEGTIGVEYTPPPVGETSDIQTYDCANCRGLLTLRCERCPTCNELIDWTSLDDNI*
Ga0181388_109461313300017724SeawaterKKKTVLMEPEAAIPAQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNESIDWSSLDAV
Ga0181419_111145133300017728SeawaterMPKKKTVLMEPEAPAIVQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNEPIDWSSLN
Ga0181396_111537323300017729SeawaterMPKKKTILMEPEAAIPTQAEALTISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNEPIDWSSLDNA
Ga0181416_102962833300017731SeawaterMPKKKTILMEPEAAIPAQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNEPIDWSSLDNA
Ga0181397_109217333300017744SeawaterMPKKTTVLMEPEAAISTQVEAPAISEGSIGVEYTPPPVGQREEVQTYDCGNCRGDLPLRCERCPICNEPIDWSGLD
Ga0181397_109589523300017744SeawaterMPKKKTVLMEPEAPAIVQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNESIDWSSLDAV
Ga0181397_111299723300017744SeawaterMPKKKTILMEPEAAIPVQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNEPIDWSSLDNA
Ga0181407_113672333300017753SeawaterMPKKKTVLMEPEAPAIVQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNEPIDWSGLD
Ga0181420_100581073300017757SeawaterMPKKKTVLMEPEAAIPAQVEAPPISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNESIDWSSLDAV
Ga0181420_100887153300017757SeawaterMPKKKTILMEPEAAIPTQAEALTISEGSIGVEYTPPPVGEREEVQTYDCGNCRANLPLRCERCPICNEPIDWSSLDNA
Ga0181420_102478043300017757SeawaterMPKKKTILMEPEAAIPAQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNEPINWSSLDNA
Ga0187220_122075523300017768SeawaterMPKKKTILMEPEAAIPAQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNESIDWSSLDAV
Ga0181430_101447443300017772SeawaterMTKKKTILMEPEAAIPAQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRSERCPICNEPIDWSSLDNA
Ga0181430_113367313300017772SeawaterMPKKKTILMEPEAAIPTQAEALTISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCER
Ga0181430_123921823300017772SeawaterMHYLVFYYRGEIMPKKTTVLMEPEAAISTQVEAPAISEGSIGVEYTPPPVGQREEVQTYDCGNCRGDLPLRCERCPICNEPIDWSGLD
Ga0181386_107231733300017773SeawaterTYNRGEIMPKKKTILMEPEAAIPAQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNEPIDWSSLDNA
Ga0181432_100062763300017775SeawaterMPKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREEEQRYDCANCQGELPLRAERCPTCNESIDWSSLDN
Ga0181432_100888843300017775SeawaterMAKKKTTVMLEPDPGLPVPVVTDGTIGVEYTPPPVGEREEEDTYDCANCQGDLPLRAERCPTCNELINWSSLDVI
Ga0181432_101292723300017775SeawaterMPKKKTTVLLEPETVDPVPVISDGTIGVEYTPPPVGEREEVPTYDCANCRGDLPLRAERCPTCNESIDWSSLDA
Ga0181432_101503823300017775SeawaterMPKKKTTVLLEPEPGVPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDA
Ga0181432_102798443300017775SeawaterGEIMPKKKTVLMEPEAAVPAQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNEPIDWSSLDNA
Ga0181432_104274923300017775SeawaterMPKKKTTVLLEPETVDPVPVVTDGTIGVEYTPPPVGEREEVPTYDCANCRGDLPLRAERCPTCNESIDWSSLDAD
Ga0181432_104313643300017775SeawaterMPKKKTVLMEPETAIPAQVEAPTISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNEPIDWSSLDNA
Ga0181432_105879023300017775SeawaterMPKKKTVLMEPEAAIPAQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPICNESIDWSSLDNA
Ga0181432_107165823300017775SeawaterMVRKSRAKPAQLLEPENAGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNESIDWSSLDG
Ga0181432_107421333300017775SeawaterMAKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNESIDWSSLDG
Ga0181432_107791923300017775SeawaterMPKKKPPVMLEPESGISAPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDN
Ga0181432_108049923300017775SeawaterMPKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREDVETYDCANCRGDLPLRAERCPTCNELIDWSSLDN
Ga0181432_112943033300017775SeawaterMAKKKTTVLLEPENAGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERC
Ga0181432_114858513300017775SeawaterLPKKKTTVMLEPETIAPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERC
Ga0181432_127498523300017775SeawaterLPKKKTTLMLEPENVGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGALPLRAERCPTCNESIDWSSLDN
Ga0211637_1008380533300020398MarineMAKKKTTVLLEPDPGLPVPVVTDGTIGVEYTPPPVGEREEEDTYDCANCQGDLPLRAERCPTCNELINWSSLDA
Ga0211578_1007548033300020444MarineMPKKKTTVLLEPETVDPVPVITDGTIGVEYTPPPVGERQEVPTYDCANCRGDLPLRSERCPTCNESIDWSSLDAD
Ga0211697_1049674713300020458MarineVIRGGTMPKKKTTVLLEPETGAPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNESIDWSSLDN
Ga0232639_111630923300021977Hydrothermal Vent FluidsMAKKKTTVLLEPEPGVPAPVVTDGTIGVEYTPPPAGEREEAQTYDCANCQGDLPLRAERCPTCNESINWSSLDN
Ga0207889_100360723300025042MarineMPKKKTTVMLEPETAGPVPVVTEGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELIDWSSLDN
Ga0207892_100309113300025050MarineTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELIDWSSLDN
Ga0207906_1000872103300025052MarineMPRKKTVLMEPEAAIPAQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRADLPLRCERCPVCNEPIDWSSLDNA
Ga0207906_103831433300025052MarineAPAIAQVEAPAISEGSIGVEYTPPPVGEREEVQTYDCGNCRGEIPLRCERCPICNEPIDWSSLNAV
Ga0209434_106442223300025122MarineLPKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNESIDWSSLDN
Ga0209434_116781713300025122MarineMPKKKTTVLLEPETVDPVPVITDGTIGVEYTPPPVGERQEVPTYDCANCRGDLPLRAERCPTCNESIDWSSLDVD
Ga0209644_101342243300025125MarineMVRKSRAKPAQLLEPENVGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELIDWSSLDAI
Ga0209644_105693523300025125MarineMAKKKTTVLLEPEPGVPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDN
Ga0207903_109391723300025287Deep OceanLPKKKTTVMLEPDNAAPVPVVTDGTIGVEYTPPPVGEREEAQTYLCANCQGEIELRSPRCQTCNESIDWSSLDD
Ga0209757_1001684033300025873MarineMVRKSRAKPAQLLEPENAVPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDN
Ga0209757_1001959843300025873MarineMVSLNRGDRMVRKSRAKPAKLLEPEDADPQLPVSDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDN
Ga0209757_1003590623300025873MarineMAKKKTTVLLEPENAGPVPVVTDGTIGVEYTPPPVGEREEADTYDCANCRGDLPLRAERCPTCNESIDWSSLDD
Ga0209757_1004272123300025873MarineMAKKKTTVLLEPESGVPVPVVTDGTIGVEYTAPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDG
Ga0209757_1004878023300025873MarineMVRKSRAKPAQLLEPETIGPVPVVTDGTIGVEYTPPPVGEREEVQTYDCANCQGDLPLRAERCPTCNELINWSSLDAD
Ga0209757_1009315823300025873MarineMARKSRAKPAQLLEPENAGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGELPLRAERCPTCNELIDWSSLDA
Ga0209757_1010397323300025873MarineMAKKKTTVLLEPESGVPVPVVTDGTIGVEYTPPPVGEREEAQPYDCANCQGDLPLRAQRCPTCNESIDWSSLDN
Ga0209757_1011408743300025873MarineMAKKKTTVLLEPESGIPVPVVTEGTIGVEYTPPPVGEREEAQTYDCANCQGDLTLRADRC
Ga0209757_1016106813300025873MarineMPKKKTTVMLEPETIAPVPVVTDGTIGVEYAPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELIDWTSLDN
Ga0209757_1016975113300025873MarineMPKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNESIDWSSLDN
Ga0209757_1019063923300025873MarineMAKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREDAQTYDCANCQGDLPLRAERCPTCNELINWSSLDN
Ga0209089_1030607023300027838MarineMPKKKTVLMEPEAPAIAQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRCERCPTCNESIDWSSLDT
Ga0209089_1058229223300027838MarineKTTVLMEPEAAIPVQVEAPAISEGSIGVEYTPPPVGDREESQTYDCANCRGDLPLRCERCPTCNESIDWSSLDA
Ga0209403_1011964723300027839MarineMPKKKTTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCNESIDWSSLDT
Ga0209403_1014669323300027839MarineMPKKKTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQAYDCANCRGEIPLRAERCPTCNESIDWSSLDN
Ga0209403_1021678133300027839MarineMPKKKTVLMEPEAAIPVQVEAPAISEGSIGVEYTPPPVGDREESQTYDCANCRGDLPLRCERCPTCNESIDWSSLDA
Ga0209403_1047902413300027839MarineMPKKKTTVLMEPEAAIPVQLEAPAISEGSIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPICNEPIDWSSLDA
Ga0209501_1003409973300027844MarineMPKKKTTVLMEPEAAIPVQVEAPAISEGSIGVEYTPPPVGDREESQTYDCANCRGDLPLRCERCPTCNESIDWSSLDA
Ga0209501_1020689043300027844MarineMPKKKTVLMEPEAAIPVQVEAPAISEGTIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPICNE
Ga0209501_1028692723300027844MarineMPKKKTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCNESIDWSSLDT
Ga0209501_1055432513300027844MarineMPKKKTTVLMEPEAAIPVQLEAPAISEGSIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPICNEPID
Ga0209402_1021434443300027847MarineMPKKKTVLMEPEAAIPVQVEAPAISEGTIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPICNESIDWSSLDA
Ga0209402_1027600833300027847MarineLMEPEAAIPVQVEAPAISEGTIGVEYTPPPVGDREESQTYDCANCRGDLPLRCERCPTCNESIDWSSLDA
Ga0209402_1054551323300027847MarineMPKKKTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGDIPLRAERCPTCNESIDWSSLDT
Ga0302132_1041630523300031605MarineMPKKKPVLMEPEAPAMVQVEAPAISEGTIGVEYTPPPVGETSDIQTYDCANCRGLLTLRCERCPTCNELIDWTSLDDNT
Ga0302123_1002235473300031623MarineMPKKKTVLMEPEAPAIVQVDAPAIREGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCN
Ga0302123_1003799743300031623MarineMPKKKTTVLMEPEAAIPVQVEAPAISEGSIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPTCNESIDWSSLDA
Ga0302123_1005509543300031623MarineMPKKKTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCN
Ga0302123_1008421743300031623MarineMPKKKTVLMEPEVVTTAQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRCERCPTCNESIDWGSLDN
Ga0302123_1011232413300031623MarineMPKKKTVLMEPDVTTTAQVEAPAISEGSIGVEYSPPPVGEREEEQTYDCANCRGDIPLRCERCPTCNESIDWSSLDNA
Ga0302123_1016816723300031623MarineMPKKKTVLMEPEAPTTTQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCNESIDWSSLDN
Ga0302123_1043538023300031623MarineMPKKKTVLMEPEAAIPAQVDAPAISEGSIGVEYTPPPVGEREEEQIYDCANCRGEIPLRAERCPTCNESIDWRSLDT
Ga0302135_1001365613300031625MarineMPKKKTVLMEPEAPAIVQVDAPAIREGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCP
Ga0302118_1010061033300031627MarineMPKKKTVLMEPEAAIPAQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCNES
Ga0302118_1025862813300031627MarineMPKKKTVLMEPEAPAMVQVEAPAISEGTIGVEYTPPPVGETSDIQTYDCANCRGLLTLRCERCPTCNELIDWTSLDDNI
Ga0302133_1000859283300031646MarineMPKKKTVLMEPEAAIPVQVEAPAISEGTIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPICNEPIDWSSLDA
Ga0302133_1002038653300031646MarineMPKKKTVLMEPDVTTTAQVEAPAISEGSIGVEYSPPPVGEREEEQTYDCANCRGDIPLRCERCPTCNESIDWSSLDG
Ga0302139_1027660633300031693MarineMPKKKTTVLMEPEAAIPVQLEAPAISEGSIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPICNEPIDWS
Ga0302139_1028271613300031693MarineMPKKKTTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRAERCPTCNESIDW
Ga0310122_1001533753300031800MarineLPKKKTTKMLEPETGAPSLPVSEGTIGVEYTPPPVGEREEAQIYLCANCQGEIELRSPRCQTCNESIDWSSLDD
Ga0310121_10009390143300031801MarineMPKKKTTVLMEPEAPVTAQVEAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGDIPLRCERCPICNESIDWSSLDA
Ga0310121_1003118763300031801MarineMPKKKTVLMEPEAAIPAQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGDLPLRAERCPICNESIDWSSLDA
Ga0310121_1028408113300031801MarineMPKKKTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGDIPLRCERCPTCNELIDWSSLDA
Ga0310121_1045110623300031801MarineKKKTVLMEPDVTTTAQVEAPAISEGSIGVEYSPPPVGEREEEQTYDCANCRGDIPLRCERCPTCNESIDWSSLDA
Ga0310123_1000804743300031802MarineMPKKKTTVLLEPENAGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDN
Ga0310123_10008253133300031802MarineMPKKKTVLMEPEAPATAQVDAPEISEGSIGVEYTPPPVGEREEEQTYDCANCRGEIPLRCERCPTCNELIDWSSLDA
Ga0310123_1002394523300031802MarineMPKKKTVLMEPDVTTTAQVEAPAISEGSIGVEYSPPPVGEREEEQTYDCANCRGDIPLRCERCPTCNESIDWSSLDT
Ga0310123_1003347053300031802MarineMAKKKTTVLLEPENAGPIPVVSDGSIGVEYTPPPVGEREEGQTYDCANCLGDLPLRAERCPTCNESIDWSGLDN
Ga0310123_1009121553300031802MarineMPKKKTVLMEPEAPAIVQVDAPAISEGSIGVEYTPPPVGEREEEQTYDCANCRGDIPLRCERCPTCNESIDWSSLDA
Ga0310123_1010283133300031802MarineMPKKKTTVMLEPETIAPVPVVTDGTIGVEYTPPPVGEREEVQTYDCANCQGDLPLRAERCPTCNESIDWSSLDN
Ga0310123_1011846323300031802MarineMPKKKTTVLLEPEPGVPVPVVTDGTIGVEYTPPPVGEREEEDTYDCANCQGDLPLRAERCPTCNELINWSSLDN
Ga0310123_1033940623300031802MarineMPKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRADRCPTCNESIDWSSLDN
Ga0310124_1021167533300031804MarineMPKKKTVLMEPEAPAIVQVEAPAITEGSIGVEYTPPPVGEREEEQTYDCAHCRGDLPLRAERCPTCNESIDWSSLDA
Ga0310345_1003902063300032278SeawaterLPKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREEVQTYDCANCQGDLPLRAERCPTCNELIDWSSLDA
Ga0310345_1008706133300032278SeawaterMPKKKTTVMLEPETIAPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNESIDWSSLDA
Ga0310345_1009559943300032278SeawaterMPKKKTTVLLEPETVDPVPVITDGTIGVEYTPPPVGEREEVPTYDCANCRGDLPLRAERCPTCNESIDWSSLDAD
Ga0310345_1033538243300032278SeawaterLPKKKTTVMLEPETIGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGALPLRAERCPTCNESIDWSSLDN
Ga0314858_140366_395_6193300033742Sea-Ice BrineNTTVLMEPEAAIPVQVEAPAISEGSIGVEYTPPPVGEREESQTYDCANCRGDLPLRCERCPTCNESIDWSSLDA
Ga0326755_010501_559_7593300034628Filtered SeawaterMLEPDNAAPVPVVTDGTIGVEYTPPPVGEREEAQTYLCANCQGEIELRSPRCQTCNESIDWSSLDD
Ga0326741_073694_124_3483300034654Filtered SeawaterMAKKKTTVLLEPENAGPVPVVTDGTIGVEYTPPPVGEREEAQTYDCANCQGDLPLRAERCPTCNELINWSSLDG
Ga0326741_090832_299_4993300034654Filtered SeawaterLLEPETGAPSLPVSEGTIGVEYTPPPVGEREESQKYLCANCQGEIELRSPRCQTCNESIDWSSLDN
Ga0326748_009817_454_6783300034656Filtered SeawaterMPKKKTTKMLEPETGAPSLPVSEGTIGVEYTPPPVGEREETQVYLCANCQGEIELRSPRCQTCNESIDWSSLDD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.