Basic Information | |
---|---|
Family ID | F057774 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 136 |
Average Sequence Length | 41 residues |
Representative Sequence | MVSVVVSIRMRKMFAEVRKMFLNARHAEQDVRERQASRNF |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 48.15 % |
% of genes near scaffold ends (potentially truncated) | 43.38 % |
% of genes from short scaffolds (< 2000 bps) | 68.38 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.265 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.912 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (75.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF07676 | PD40 | 13.24 |
PF00069 | Pkinase | 5.15 |
PF02518 | HATPase_c | 2.21 |
PF03176 | MMPL | 1.47 |
PF12706 | Lactamase_B_2 | 1.47 |
PF16916 | ZT_dimer | 1.47 |
PF13517 | FG-GAP_3 | 1.47 |
PF03704 | BTAD | 1.47 |
PF07883 | Cupin_2 | 1.47 |
PF00291 | PALP | 1.47 |
PF12833 | HTH_18 | 1.47 |
PF02502 | LacAB_rpiB | 0.74 |
PF00756 | Esterase | 0.74 |
PF05193 | Peptidase_M16_C | 0.74 |
PF01794 | Ferric_reduct | 0.74 |
PF03551 | PadR | 0.74 |
PF01035 | DNA_binding_1 | 0.74 |
PF00571 | CBS | 0.74 |
PF00127 | Copper-bind | 0.74 |
PF00107 | ADH_zinc_N | 0.74 |
PF00440 | TetR_N | 0.74 |
PF03779 | SPW | 0.74 |
PF07786 | HGSNAT_cat | 0.74 |
PF07609 | DUF1572 | 0.74 |
PF13360 | PQQ_2 | 0.74 |
PF02368 | Big_2 | 0.74 |
PF01957 | NfeD | 0.74 |
PF06719 | AraC_N | 0.74 |
PF00248 | Aldo_ket_red | 0.74 |
PF14905 | OMP_b-brl_3 | 0.74 |
PF13673 | Acetyltransf_10 | 0.74 |
PF13424 | TPR_12 | 0.74 |
PF13683 | rve_3 | 0.74 |
PF04239 | DUF421 | 0.74 |
PF02012 | BNR | 0.74 |
PF08240 | ADH_N | 0.74 |
PF10502 | Peptidase_S26 | 0.74 |
PF07963 | N_methyl | 0.74 |
PF01425 | Amidase | 0.74 |
PF13540 | RCC1_2 | 0.74 |
PF11999 | Ice_binding | 0.74 |
PF00561 | Abhydrolase_1 | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 20.59 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.47 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.47 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 1.47 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 1.47 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.74 |
COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 0.74 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.74 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.74 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.74 |
COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 0.74 |
COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.74 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.74 |
COG4977 | Transcriptional regulator GlxA, contains an amidase domain and an AraC-type DNA-binding HTH domain | Transcription [K] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.26 % |
Unclassified | root | N/A | 25.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090004|P1_DRAFT_NODE_206278_len_858_cov_6_702797 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
2088090008|P3_DRAFT_NODE_420112_len_1232_cov_16_381493 | Not Available | 1282 | Open in IMG/M |
2088090008|P3_DRAFT_NODE_428401_len_1944_cov_9_605453 | Not Available | 1994 | Open in IMG/M |
2088090008|P3_DRAFT_NODE_504412_len_1355_cov_10_144650 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
2124908032|Perma_A_C_ConsensusfromContig140065 | Not Available | 1452 | Open in IMG/M |
2124908041|P3_CLC_ConsensusfromContig123041 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
2124908041|P3_CLC_ConsensusfromContig152170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 667 | Open in IMG/M |
2124908041|P3_CLC_ConsensusfromContig37964 | Not Available | 2507 | Open in IMG/M |
2124908041|P3_CLC_ConsensusfromContig59483 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
2140918006|ConsensusfromContig89048 | Not Available | 1126 | Open in IMG/M |
2140918007|ConsensusfromContig148464 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_69_8 | 1324 | Open in IMG/M |
3300000886|AL3A1W_1021947 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 658 | Open in IMG/M |
3300001324|A2635W6_108741 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300001333|A21PFW6_1036661 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300001334|A2165W6_1000539 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300001359|A3035W6_1030351 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300001359|A3035W6_1193089 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
3300001402|JGI20195J14853_1003170 | All Organisms → cellular organisms → Bacteria | 5211 | Open in IMG/M |
3300001406|JGI20187J14854_1005574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 694 | Open in IMG/M |
3300001409|JGI20185J14861_1001522 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2853 | Open in IMG/M |
3300001409|JGI20185J14861_1006408 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300001409|JGI20185J14861_1008560 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300001535|A3PFW1_10108844 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
3300001538|A10PFW1_11121370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 706 | Open in IMG/M |
3300001664|P5cmW16_1027979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
3300002025|smpD1_1106176 | Not Available | 667 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100287965 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300005171|Ga0066677_10830580 | Not Available | 510 | Open in IMG/M |
3300005181|Ga0066678_10026966 | All Organisms → cellular organisms → Bacteria | 3082 | Open in IMG/M |
3300005454|Ga0066687_10044310 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
3300005518|Ga0070699_100043428 | All Organisms → cellular organisms → Bacteria | 3891 | Open in IMG/M |
3300005540|Ga0066697_10224293 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300005553|Ga0066695_10336255 | Not Available | 948 | Open in IMG/M |
3300005553|Ga0066695_10752966 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
3300005554|Ga0066661_10662923 | Not Available | 614 | Open in IMG/M |
3300005557|Ga0066704_10440256 | Not Available | 862 | Open in IMG/M |
3300005560|Ga0066670_10119563 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1503 | Open in IMG/M |
3300005561|Ga0066699_10980614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 586 | Open in IMG/M |
3300005576|Ga0066708_10157518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1400 | Open in IMG/M |
3300005576|Ga0066708_10169536 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300005576|Ga0066708_10218133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1203 | Open in IMG/M |
3300005586|Ga0066691_10503968 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 723 | Open in IMG/M |
3300005938|Ga0066795_10143343 | Not Available | 712 | Open in IMG/M |
3300005947|Ga0066794_10014189 | Not Available | 2270 | Open in IMG/M |
3300005947|Ga0066794_10126596 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300005947|Ga0066794_10127180 | Not Available | 765 | Open in IMG/M |
3300006055|Ga0097691_1003698 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 9341 | Open in IMG/M |
3300006055|Ga0097691_1011039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4455 | Open in IMG/M |
3300006055|Ga0097691_1068369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1144 | Open in IMG/M |
3300006640|Ga0075527_10047847 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1153 | Open in IMG/M |
3300006800|Ga0066660_10057645 | Not Available | 2571 | Open in IMG/M |
3300006864|Ga0066797_1026675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2024 | Open in IMG/M |
3300006864|Ga0066797_1175380 | Not Available | 749 | Open in IMG/M |
3300006954|Ga0079219_10026811 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2221 | Open in IMG/M |
3300007821|Ga0104323_124786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1912 | Open in IMG/M |
3300009029|Ga0066793_10014096 | All Organisms → cellular organisms → Bacteria | 4267 | Open in IMG/M |
3300009029|Ga0066793_10192317 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1188 | Open in IMG/M |
3300009029|Ga0066793_10620488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300009649|Ga0105855_1248009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 550 | Open in IMG/M |
3300009660|Ga0105854_1092830 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 938 | Open in IMG/M |
3300010396|Ga0134126_11254657 | Not Available | 822 | Open in IMG/M |
3300011227|Ga0137475_101564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1566 | Open in IMG/M |
3300011246|Ga0137490_1000642 | All Organisms → cellular organisms → Bacteria | 5291 | Open in IMG/M |
3300011992|Ga0120146_1004512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3591 | Open in IMG/M |
3300011992|Ga0120146_1009366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2125 | Open in IMG/M |
3300011994|Ga0120157_1007005 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3176 | Open in IMG/M |
3300011996|Ga0120156_1006214 | All Organisms → cellular organisms → Bacteria | 2677 | Open in IMG/M |
3300011998|Ga0120114_1003509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4139 | Open in IMG/M |
3300011998|Ga0120114_1053674 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 789 | Open in IMG/M |
3300012001|Ga0120167_1033629 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1201 | Open in IMG/M |
3300012003|Ga0120163_1007024 | All Organisms → cellular organisms → Bacteria | 4359 | Open in IMG/M |
3300012003|Ga0120163_1052349 | Not Available | 984 | Open in IMG/M |
3300012004|Ga0120134_1076226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 608 | Open in IMG/M |
3300012010|Ga0120118_1041337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1183 | Open in IMG/M |
3300012014|Ga0120159_1014383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3136 | Open in IMG/M |
3300012014|Ga0120159_1025219 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
3300012019|Ga0120139_1049760 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300012199|Ga0137383_10236801 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
3300012208|Ga0137376_10224885 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1626 | Open in IMG/M |
3300012208|Ga0137376_11600812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
3300012285|Ga0137370_10050065 | Not Available | 2238 | Open in IMG/M |
3300012285|Ga0137370_10954050 | Not Available | 529 | Open in IMG/M |
3300012469|Ga0150984_116585091 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
3300012923|Ga0137359_10264472 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1534 | Open in IMG/M |
3300012925|Ga0137419_10869683 | Not Available | 741 | Open in IMG/M |
3300013294|Ga0120150_1001333 | All Organisms → cellular organisms → Bacteria | 6746 | Open in IMG/M |
3300013294|Ga0120150_1041196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 902 | Open in IMG/M |
3300013294|Ga0120150_1104049 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 535 | Open in IMG/M |
3300013501|Ga0120154_1004934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4063 | Open in IMG/M |
3300013758|Ga0120147_1015259 | Not Available | 1547 | Open in IMG/M |
3300013764|Ga0120111_1003393 | All Organisms → cellular organisms → Bacteria | 5840 | Open in IMG/M |
3300013764|Ga0120111_1010793 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2810 | Open in IMG/M |
3300013768|Ga0120155_1036250 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300013772|Ga0120158_10338280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 713 | Open in IMG/M |
3300014052|Ga0120109_1023536 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1377 | Open in IMG/M |
3300014823|Ga0120170_1107861 | Not Available | 560 | Open in IMG/M |
3300015079|Ga0167657_1014678 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300015079|Ga0167657_1037460 | Not Available | 570 | Open in IMG/M |
3300015080|Ga0167639_1044823 | Not Available | 567 | Open in IMG/M |
3300015192|Ga0167646_1000804 | All Organisms → cellular organisms → Bacteria | 11483 | Open in IMG/M |
3300015192|Ga0167646_1043645 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1051 | Open in IMG/M |
3300015193|Ga0167668_1003853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3297 | Open in IMG/M |
3300015193|Ga0167668_1004923 | Not Available | 2964 | Open in IMG/M |
3300015199|Ga0167647_1004936 | All Organisms → cellular organisms → Bacteria | 4470 | Open in IMG/M |
3300017659|Ga0134083_10599871 | Not Available | 503 | Open in IMG/M |
3300017695|Ga0180121_10386145 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300018000|Ga0184604_10001081 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3656 | Open in IMG/M |
3300018028|Ga0184608_10009921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 3216 | Open in IMG/M |
3300018051|Ga0184620_10324293 | Not Available | 521 | Open in IMG/M |
3300018061|Ga0184619_10003047 | All Organisms → cellular organisms → Bacteria | 6130 | Open in IMG/M |
3300018075|Ga0184632_10223788 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300018433|Ga0066667_10482916 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300019887|Ga0193729_1110450 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1035 | Open in IMG/M |
3300019887|Ga0193729_1199096 | Not Available | 684 | Open in IMG/M |
3300020015|Ga0193734_1042116 | Not Available | 849 | Open in IMG/M |
3300021344|Ga0193719_10013153 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 3488 | Open in IMG/M |
3300021363|Ga0193699_10328815 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300022756|Ga0222622_10683356 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300025505|Ga0207929_1000757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8693 | Open in IMG/M |
3300025505|Ga0207929_1007223 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
3300025505|Ga0207929_1033967 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 971 | Open in IMG/M |
3300025922|Ga0207646_10009303 | All Organisms → cellular organisms → Bacteria | 9716 | Open in IMG/M |
3300026271|Ga0209880_1014531 | Not Available | 2016 | Open in IMG/M |
3300026523|Ga0209808_1181799 | Not Available | 743 | Open in IMG/M |
3300027603|Ga0209331_1046485 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300027645|Ga0209117_1105585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300027651|Ga0209217_1008037 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3493 | Open in IMG/M |
3300027651|Ga0209217_1030277 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
3300027674|Ga0209118_1022274 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
3300027674|Ga0209118_1110081 | Not Available | 774 | Open in IMG/M |
3300027748|Ga0209689_1146542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1144 | Open in IMG/M |
3300027775|Ga0209177_10016228 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1768 | Open in IMG/M |
3300028715|Ga0307313_10258388 | Not Available | 542 | Open in IMG/M |
3300031421|Ga0308194_10121833 | Not Available | 775 | Open in IMG/M |
3300032180|Ga0307471_100544147 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 25.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.76% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 8.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 8.09% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 6.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.15% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 5.15% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.15% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.68% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 2.21% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.47% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.74% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.74% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
Permafrost And Active Layer Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.74% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
Cryoconite Hole, Glacier Surface | Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Cryoconite Hole, Glacier Surface | 0.74% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
3300001324 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A26-35cm)- 6 month illumina | Environmental | Open in IMG/M |
3300001333 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-PF)- 6 month illumina | Environmental | Open in IMG/M |
3300001334 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illumina | Environmental | Open in IMG/M |
3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
3300001406 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 | Environmental | Open in IMG/M |
3300001409 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
3300002025 | Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_D1 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011227 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 10 - S13.1.50.a - transect 1, age 50 years, surface depth). | Environmental | Open in IMG/M |
3300011246 | Glacer surface microbial communities from an Arctic cyroconite hole, Midre Lovenbreen, Svalbard, Norway (Sample 22) | Environmental | Open in IMG/M |
3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P1_DRAFT_00522990 | 2088090004 | Soil | MVSVVVSIRMRKMFVEMRSMFVNARHAEQDIRERQASKNF |
P3_DRAFT_00285690 | 2088090008 | Soil | MVSVVVSIRMRKMFAEVRKTFLNARHAEQDVREMQASWNF |
P3_DRAFT_00804870 | 2088090008 | Soil | MVSVVVSIQMRKMFAEVRKMFLNARHAEQDVRERQASRNF |
P3_DRAFT_00856040 | 2088090008 | Soil | MVSVVVSVVESIRMRKMFVEMRSMFVNARHAEQDIRERQASKNF |
Perma_A_C_02648160 | 2124908032 | Soil | MVSVVSVVVSIRMRKMFAEVRKMFSNARHAEQDVRERQASR |
P3_CLC_00961350 | 2124908041 | Soil | MVSVVVSIRMRKMFAEVRKMFLNARHAEQDVRERQASKNF |
P3_CLC_00224810 | 2124908041 | Soil | SVVVSIRVRKMFAEVRKMFLNARHAEQDVRERQASWNF |
P3_CLC_02771600 | 2124908041 | Soil | VSIQMRKMFAEVRKMFSNARHAEQDVRERQASRNF |
P3_CLC_01226640 | 2124908041 | Soil | MNWLACSRTAMVSVVVSIRMRKMFVEVRKMFLNARDAEQ |
P1_C_00868540 | 2140918006 | Soil | MVSVVSVVVSIRMRKMFAEVRKMFSNARHAEQDVRE |
A_all_C_01440530 | 2140918007 | Soil | MVSVVVSIQMRKMFAEVRKMFSNARHAEQDVRERQASRNF |
AL3A1W_10219473 | 3300000886 | Permafrost | VSVVVSIQMRKVFAEVRKMLSNARHAEQDVRERQASKNF* |
A2635W6_1087411 | 3300001324 | Permafrost | MVSVIVSIHLRKMFVEVRKMFVNARHAEQDVRERQASRNF* |
A21PFW6_10366611 | 3300001333 | Permafrost | SVVVSIRMRKMFAEVRKIFVNARHAEQDVRERQPSKNF* |
A2165W6_10005391 | 3300001334 | Permafrost | MVSIVVSIRMRKMFAEVRNIFSNARDAEQDVRERQA |
A3035W6_10303511 | 3300001359 | Permafrost | VNWLTCSQIAMVSVVVSIQMRKMFAEARRMFVNARDAEQDVRERQASRNF* |
A3035W6_11930892 | 3300001359 | Permafrost | MVSVVVSIQMRKMFAEVRKMFVNARRAEQDVRERQASRNFCD* |
JGI20195J14853_10031701 | 3300001402 | Arctic Peat Soil | VPRGILVSVVVSIRMRKMFAEVRKMFSNARHAELDV |
JGI20187J14854_10055743 | 3300001406 | Arctic Peat Soil | QMVSVVVSIRRRKMFAQVRKMFLNARHAEQDVRERQAGRNF* |
JGI20185J14861_10015224 | 3300001409 | Arctic Peat Soil | MVSVVVSIRMRKMFAEVRNMFVNARHAEQDVREMQASXNF* |
JGI20185J14861_10064082 | 3300001409 | Arctic Peat Soil | MVSVVVSIRMRKMFAEVRKMFLNVRHAEQDVRERQAS |
JGI20185J14861_10085602 | 3300001409 | Arctic Peat Soil | VSVVVSIQMRKMFAEMRKMFSNTRDAEQDVREKAGDRNF |
A3PFW1_101088442 | 3300001535 | Permafrost | MNWLACSRIAMVSVVVSIRMRKMFAEARKMFSNARHAEQDVRERQASRNF* |
A10PFW1_111213702 | 3300001538 | Permafrost | MVSVVVSIRMRKMFAEVRKMFSNVRHAEQDVRERQASGNF* |
P5cmW16_10279791 | 3300001664 | Permafrost | VVSIQMRKVFAEVRKMHSNARHAEQDVRERQASKNF* |
smpD1_11061761 | 3300002025 | Permafrost And Active Layer Soil | MVSVVVSIRMRKMFAEVRKMLSNARQAEQDVRERQASRNF* |
JGIcombinedJ26739_1002879653 | 3300002245 | Forest Soil | VSVVVPIQMRKMFAEMRKMFSDARDAEQDVRGRQASKNF* |
Ga0066677_108305801 | 3300005171 | Soil | MVSVVVSIQMRKLFVEVRKIFVNARHAEQDVRERYASKNFSTEFMFA* |
Ga0066678_100269665 | 3300005181 | Soil | MVSVVVSIRMRKMFAKVRKMFLNARDAEQDGRETQASRNF* |
Ga0070682_1015699921 | 3300005337 | Corn Rhizosphere | MVSVGVSIPMRKLLSEVRKGFVNARGAEQDVREGQAGKNFRAEFMFV* |
Ga0066687_100443102 | 3300005454 | Soil | VSVVVSIHMRKMFAEVRKTFSNARHAEQDVRERQAGRNF* |
Ga0070699_1000434282 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSVVVSIQMRKVFAEVRKMLTNARHAEQDVRERQASKNF* |
Ga0066697_102242932 | 3300005540 | Soil | MEAVSVVVSIRMRKMFTEVRKMFLDARLAEQDVR* |
Ga0066695_103362552 | 3300005553 | Soil | MEAVSVVVFIRMRKMFTEVRKMFLDARLAEQDVR* |
Ga0066695_107529663 | 3300005553 | Soil | VSLVVSIQIRKTFAEARKMLLNARDAQQDVRERQTSRNF* |
Ga0066661_106629232 | 3300005554 | Soil | MEAVSVVVSIRMRKMFTEVRKMFLDARLAERDVR* |
Ga0066704_104402562 | 3300005557 | Soil | MVSVVVSVHTREMFAEKRKMFSNARDAKQGVRETQASRNF* |
Ga0066670_101195632 | 3300005560 | Soil | VNRLACLRIAMVSVVASIYMRKVLAEVRMMFSNARDAEQGVRERQANRNF* |
Ga0066699_109806141 | 3300005561 | Soil | RRMVSVVVSIQRRKMFVNVCKMRLNAQRAEQDVRESQASKNF* |
Ga0066708_101575182 | 3300005576 | Soil | VNRHLCGSRLVSVVVSIQMRKMFAEVRKMFLNARDAEQDVRESQASGNF* |
Ga0066708_101695363 | 3300005576 | Soil | LVVSIQMRTMFMEVHRIFLNARFAEHGVRERQAS* |
Ga0066708_102181331 | 3300005576 | Soil | LPCIAMVSVVVSIRMRKMFAEVCKMFLNGRHAEQDVRERWASRNF* |
Ga0066691_105039682 | 3300005586 | Soil | VSVVVSIQMRKVFAEVRKMLSNARHAEQDVRERQA |
Ga0066795_101433432 | 3300005938 | Soil | VPRGILVSVVVSIRMREMFAEVRKMFLNARHAEQDVRERQASWNF* |
Ga0066794_100141891 | 3300005947 | Soil | VPRGILVSVVVSIRMRKMFAEVRKMFLNARHAEQDVRE |
Ga0066794_101265962 | 3300005947 | Soil | MVSVVVSIRMRKMFAEMRKMFINARHAEQDVRERQASRNF* |
Ga0066794_101271801 | 3300005947 | Soil | MVSVVVSIQMRKMFMEVRKMFFNARLAEQDARERQASRNF* |
Ga0097691_10036989 | 3300006055 | Arctic Peat Soil | MVSVVVSIQMRKMFVEVRKMFVNARHAEQDVRERQASRNF* |
Ga0097691_10110392 | 3300006055 | Arctic Peat Soil | MVSVVVSIRMRKMFAEMRKMFLNAQHAEQDVRERQVRLFLCLL* |
Ga0097691_10683691 | 3300006055 | Arctic Peat Soil | MVSVVVSIRMRKMFAEVRKMFLNARHAEQDVRERQASRNF* |
Ga0075527_100478472 | 3300006640 | Arctic Peat Soil | VVSVVVSVRMRKMFAQVRKIFVNVKHAEQDVRERQASRNF* |
Ga0066660_100576452 | 3300006800 | Soil | MEAVSVVVSIRMRKMFTEVRKMLLDARLAEQDVR* |
Ga0066797_10266752 | 3300006864 | Soil | LPAPLKFNADVPRGILVSVVVSIRMRKMFAEVRKMFAKARDAEQDVRERQASRNF* |
Ga0066797_11753802 | 3300006864 | Soil | VVSVVVSIQMRKMFAEMRKMFSNTRDAEQDVREKAGDRNF* |
Ga0079219_100268111 | 3300006954 | Agricultural Soil | MVAVVVSIHLRKMFAEVRKSFLNARGAEQDFRERQASKNL* |
Ga0104323_1247861 | 3300007821 | Soil | MAMVSVVVSIQMRKMFAEVRKMFVNARHAEQDVRE |
Ga0066793_100140961 | 3300009029 | Prmafrost Soil | RMVSVVVSIRMRKMFAEVRKMFAKARDAEQDVRERRASRNF* |
Ga0066793_101923172 | 3300009029 | Prmafrost Soil | MVSVVVSIRMRKMFAEVRKMFLNARHAEQDVRERQASWNF* |
Ga0066793_106204883 | 3300009029 | Prmafrost Soil | MVSVVVSIRMRKMFAEVRKMFAKARDAEQDVRERQASRNF |
Ga0105855_12480091 | 3300009649 | Permafrost Soil | MVSVVVSIQMRKMFAEVRKMFSNARDAEQDVRERQAS* |
Ga0105854_10928302 | 3300009660 | Permafrost Soil | VVSVVVSIQMRKVFAEVRKMLSNARHAEQDVRERQASKNF* |
Ga0134126_112546572 | 3300010396 | Terrestrial Soil | SPIAMVAVVVSIHLRKMFAEVRKSFLNARGAEQDFRERQASKNL* |
Ga0137475_1015642 | 3300011227 | Glacier Forefield Soil | MVSVVMSIRMRKMFAEVRKTFSNAQRAEQDVRERQANWNF* |
Ga0137490_10006424 | 3300011246 | Cryoconite Hole, Glacier Surface | MVSVVVSIRMRKMFAEVRKTFSNAQRAEQDVRERQANWNF* |
Ga0120146_10045123 | 3300011992 | Permafrost | MQRNAVVSVVLSIRLRKMFLEVRKMFLSARHAEQDVRERQASRNF* |
Ga0120146_10093662 | 3300011992 | Permafrost | MVSVVVSIQMRKMFALVRKMFLNARHAEQDVRERQASKNF* |
Ga0120157_10070055 | 3300011994 | Permafrost | MVSVVVSIRMRKMFAEARKMFSNARHAEQDVRERQASRNF* |
Ga0120156_10062142 | 3300011996 | Permafrost | MVSVVVSIRMRKMFAEVRKIFVNARHAEQDVRERQPSKNF* |
Ga0120114_10035094 | 3300011998 | Permafrost | SRVAMVSVVVSIRMRKMFAEVRKIFVNARHAEQDVRERQPSKNF* |
Ga0120114_10536741 | 3300011998 | Permafrost | MVSVVVSIQMRKMFAEVRKMFVNARRAEQDIRERQASRNFCD* |
Ga0120167_10336291 | 3300012001 | Permafrost | MQRNAVVSVVLSIRLRKMFLEVRKMFLSARHAEQDVRERQA |
Ga0120163_10070245 | 3300012003 | Permafrost | VAIVSVVVSIRMRKMFAEVRKIFVNARHAEQDVRERQPSKNF* |
Ga0120163_10523492 | 3300012003 | Permafrost | GVAMVSVVVSIRMRKMFAEVRKMFSNARDAEQDVRERQASRNF* |
Ga0120134_10762261 | 3300012004 | Permafrost | MVSVVVSIQTRKMLAEVRKMFVNARDAEQDVREGQASR |
Ga0120118_10413371 | 3300012010 | Permafrost | MQRNAVVSVVLSIRLRKMFLEVRKMFLSARHAEQD |
Ga0120159_10143831 | 3300012014 | Permafrost | MVSVVVSIQMRKMFALVRKMFLNARHAEQDVRERQAS |
Ga0120159_10252192 | 3300012014 | Permafrost | MVSIVVSIRMRKMFAKVRKMFLNARHAEQDVRERQASRNF* |
Ga0120139_10497601 | 3300012019 | Permafrost | MNWLTCSQIAMVSVVVSIRMRKMFAELRKMFSNARDAEQDVRERQASRNF* |
Ga0137383_102368011 | 3300012199 | Vadose Zone Soil | MEAVSVVVSIRMRKMFTAVRKMFLDARLAEQDVR* |
Ga0137376_102248852 | 3300012208 | Vadose Zone Soil | LIQRNVVVSVVVSIRLRKMFLEVRKMFLSARHAEQDVRE |
Ga0137376_116008121 | 3300012208 | Vadose Zone Soil | MVSVVVSIGMRKMFVAARKMILNARTAEQDVRERRAGRNF* |
Ga0137370_100500652 | 3300012285 | Vadose Zone Soil | VSVVVSIQMRKMFAEVHKMLSNARNAEQDVRERLASKNF* |
Ga0137370_109540501 | 3300012285 | Vadose Zone Soil | GTGSLPCIAMVSVVVSIRMRKMFAEVRKMFLYARDAERDVRERQASRNF* |
Ga0150984_1165850913 | 3300012469 | Avena Fatua Rhizosphere | MVSVVVSIQMRKMFVEVRKTISNARHAEQVFVKRQASKNF* |
Ga0137359_102644721 | 3300012923 | Vadose Zone Soil | MEAVSVVVSIRTRKMFTEVRKMFLDARIAEQDVR* |
Ga0137419_108696832 | 3300012925 | Vadose Zone Soil | MVSVVVSIQMRKMFVEVRKMFLNARRAEQDVRARQAYRNF* |
Ga0120150_10013336 | 3300013294 | Permafrost | MVSVVVSIQMRKMFAEVRKMFVKARHAEQDVRERQASRNF* |
Ga0120150_10411961 | 3300013294 | Permafrost | MQRNAVVSVVLSIRLRKMFLEVRKMFLSARHAEQDVRERQASRN |
Ga0120150_11040491 | 3300013294 | Permafrost | MQNSVVVSIRMRKNFAEVRKMFSNARDAEQDVRERQASR |
Ga0120154_10049345 | 3300013501 | Permafrost | VSIRMRKMFAKVRKVFLNARHAEQDVRERQASRNF* |
Ga0120147_10152594 | 3300013758 | Permafrost | AMVSVVVSIQMRKMFAEVRKMFVNARRAEQDVRERQASRNFCD* |
Ga0120111_10033932 | 3300013764 | Permafrost | MVSVVVSIQMRKMFADVRTMFVNARHAEQDVRERQASWNF* |
Ga0120111_10107931 | 3300013764 | Permafrost | MVSVVVSIQMRKMFALVRKMFLNARHAEQDVRERQASRNF* |
Ga0120155_10362501 | 3300013768 | Permafrost | MVSIVVSIRMRKMFAKVRKMFLNARHAEQDVRERQ |
Ga0120158_103382802 | 3300013772 | Permafrost | MVSVLVSIHMRKMFAEVRKMFSNARDAEQDVRERQANWHF* |
Ga0120109_10235362 | 3300014052 | Permafrost | VNWLTCSQIAMVSVVVSIQMRKMFAETRRMFVNARDAEQDVRERQASRNF* |
Ga0120170_11078612 | 3300014823 | Permafrost | MQRNAVVSVVLSIRLRKMFLEVRKMFLSARHAEQDV |
Ga0167657_10146782 | 3300015079 | Glacier Forefield Soil | MVSVVVSIRMRKMFAEVRKMFLNARDAEQDVRERQASLNF* |
Ga0167657_10374602 | 3300015079 | Glacier Forefield Soil | CAYGSRMVSVVVAIRMCKMFAEVRKMFVNARHAEQDVRERQASRNF* |
Ga0167639_10448232 | 3300015080 | Glacier Forefield Soil | MEAVSVVVSIGTRKMFTEVRKMFLDARLAEQDVR* |
Ga0167646_100080413 | 3300015192 | Glacier Forefield Soil | MVSVVVSIQMRIMFAEVRKMFVNARRAEQDVRERQASRNF* |
Ga0167646_10436452 | 3300015192 | Glacier Forefield Soil | MVFVVMSIRMRKMFAEVRKTFSNAQRAEQDVRERQGNWNF* |
Ga0167668_10038533 | 3300015193 | Glacier Forefield Soil | MVSVVVSIQIDEMFVQVRKMFLNARDAEQDVREKQAS* |
Ga0167668_10049232 | 3300015193 | Glacier Forefield Soil | MVSVVVSIQMRKMFGEVRKMFSNARHAEQDVRERHANRNFSAYFMFV* |
Ga0167647_10049364 | 3300015199 | Glacier Forefield Soil | MVSVVVSIQMRKMFVEVRKMFLNARYAEQDVRERQASMHF* |
Ga0134083_105998711 | 3300017659 | Grasslands Soil | SVVVSIQMRKMFAEVRKMFLNARDAEQNGRERQASRNF |
Ga0180121_103861451 | 3300017695 | Polar Desert Sand | MVSVVVSIRMRKMFAEVRKMFLNARHAEQDVRERQAS |
Ga0184604_100010812 | 3300018000 | Groundwater Sediment | MVSVVVSIGMRKMFAEVRRMFSNSRDAEQDVSERQASRNF |
Ga0184608_100099212 | 3300018028 | Groundwater Sediment | MVSVVVSIGMRKMFAEVRRMFSNARDAEQDVSERQASRNF |
Ga0184620_103242932 | 3300018051 | Groundwater Sediment | MVSVVVSIGMRKMFAEVRRMFSNARDAEQDLSERQASRNFCAYFMFV |
Ga0184619_100030472 | 3300018061 | Groundwater Sediment | MVSVVVSIQMRKMFAEVRKMFVKARRAEQVVRERQASRNF |
Ga0184632_102237881 | 3300018075 | Groundwater Sediment | MVSVVVSIQMRKMFAEVRKMFSNARDAEQDVRERQASKNF |
Ga0066667_104829162 | 3300018433 | Grasslands Soil | VSVVVSIQMRKMFVEVRKMFLNARDAEQDVRLVDNQRRRA |
Ga0193729_11104502 | 3300019887 | Soil | MVSVVVSIQMRKMFAEVRKMFSNARGAEQDVRERQASKNF |
Ga0193729_11990961 | 3300019887 | Soil | ESVVVSVRMHKMLVEVRKMFLNARHAEQDVRERQATRNF |
Ga0193734_10421161 | 3300020015 | Soil | DSLAVVVSVVVSIQMRKMFAEVCKMFVNVRHAEQDVRERQA |
Ga0193719_100131532 | 3300021344 | Soil | MVSVVVSIGMRKMFAEVRRMFSNARDAEQDLSERQASRNF |
Ga0193699_103288152 | 3300021363 | Soil | MADVSVVVSIQMRKIFAEVRKMFLNARDAEQDGRERQASKNF |
Ga0222622_106833561 | 3300022756 | Groundwater Sediment | VVSIVVSIQLRKIFVQVRKMFSNARGAEQDVRESQASKNF |
Ga0207929_10007573 | 3300025505 | Arctic Peat Soil | VVSVVVSIQMRKMFAEMRKMFSNTRDAEQDVREKAGDRNF |
Ga0207929_10072232 | 3300025505 | Arctic Peat Soil | MVSVVVSIRMRKMFAEVRNMFVNARHAEQDVREMQASWNF |
Ga0207929_10339671 | 3300025505 | Arctic Peat Soil | MVSVVVSIRMRKMFAEVRKMFANARQAEQDVCERQASMNF |
Ga0207646_100093035 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSVVVSIQMRKVFAEVRKMLTNARHAEQDVRERQASKNF |
Ga0209880_10145312 | 3300026271 | Soil | VPRGILVSVVVSIRMREMFAEVRKMFLNARHAEQDVRERQASWNF |
Ga0209808_11817991 | 3300026523 | Soil | QSKVPAEVNRHLCGSRLVSVVVSIQMRKMFAEVRKMFLNARDAEQDVRESQASGNF |
Ga0209331_10464851 | 3300027603 | Forest Soil | MVSVVVSIQLRKMFAEVRKMFSNARDAEQDVRERQASRNFCDL |
Ga0209117_11055851 | 3300027645 | Forest Soil | MVSVVVSIQLRKMFAEVRKMFSNARHAEQDVRERQASRNF |
Ga0209217_10080372 | 3300027651 | Forest Soil | MVSVVVSIQMRKMFAEVRKMFVNARRAEQDVRERQASRNF |
Ga0209217_10302772 | 3300027651 | Forest Soil | MVSIRMRKMFAEVRKMLVNARHAEQDVRERQASMNF |
Ga0209118_10222742 | 3300027674 | Forest Soil | MEAVSIVVSIRMRKMFTEVRKMFVNARRAEQDVRERQASRNF |
Ga0209118_11100811 | 3300027674 | Forest Soil | MVSVVVSIQMRKMFQMRKMFVEVRKMFSNARRAEQDVRES |
Ga0209689_11465422 | 3300027748 | Soil | RADFLVSVVVSIQMRKVFAEVRKMLSNARHAEQDVRERQARKNF |
Ga0209177_100162281 | 3300027775 | Agricultural Soil | VAAVVSINIRKMFAEVRKSFLNARGAEQDFRERQASKNL |
Ga0307313_102583882 | 3300028715 | Soil | TVSVVVSIRTRKTFAEVRKMFSNARHAEQDVREMQAS |
Ga0308194_101218331 | 3300031421 | Soil | LKEATQVMVSVVVSIQMRKIFVQVRKMFSNAPDAEQDVRER |
Ga0307471_1005441471 | 3300032180 | Hardwood Forest Soil | VNSPLARGGVVSAVVSIRMREIFAEVRKMFSNARDAEQDVRE |
⦗Top⦘ |