NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011246

3300011246: Glacer surface microbial communities from an Arctic cyroconite hole, Midre Lovenbreen, Svalbard, Norway (Sample 22)



Overview

Basic Information
IMG/M Taxon OID3300011246 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0121480 | Gp0155996 | Ga0137490
Sample NameGlacer surface microbial communities from an Arctic cyroconite hole, Midre Lovenbreen, Svalbard, Norway (Sample 22)
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Bristol
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size61826702
Sequencing Scaffolds10
Novel Protein Genes10
Associated Families10

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales1
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetagenomes Of Arctic Soils
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Unclassified → Unclassified → Unclassified → Cryoconite Hole, Glacier Surface → Metagenomes Of Arctic Soils

Alternative Ecosystem Assignments
Environment Ontology (ENVO)polar biome → cryoconite hole → ice
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationMidre Lovenbreen Svalbard, Norway
CoordinatesLat. (o)79.48416667Long. (o)12.09222222Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008637Metagenome / Metatranscriptome330Y
F023385Metagenome / Metatranscriptome210Y
F042189Metagenome158Y
F044449Metagenome / Metatranscriptome154Y
F056330Metagenome / Metatranscriptome137Y
F057774Metagenome / Metatranscriptome136Y
F061998Metagenome / Metatranscriptome131Y
F065820Metagenome127Y
F086028Metagenome / Metatranscriptome111Y
F087644Metagenome / Metatranscriptome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0137490_1000307Not Available9168Open in IMG/M
Ga0137490_1000642All Organisms → cellular organisms → Bacteria5291Open in IMG/M
Ga0137490_1000999All Organisms → cellular organisms → Bacteria4049Open in IMG/M
Ga0137490_1001950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales2655Open in IMG/M
Ga0137490_1002903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2096Open in IMG/M
Ga0137490_1003415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales1926Open in IMG/M
Ga0137490_1007086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1260Open in IMG/M
Ga0137490_1010835Not Available954Open in IMG/M
Ga0137490_1014330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium780Open in IMG/M
Ga0137490_1018136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria652Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0137490_1000307Ga0137490_10003076F044449MAEIGEPERVVRRERENEPAITPSQPVTTPELEPAK*
Ga0137490_1000642Ga0137490_10006424F057774MVSVVVSIRMRKMFAEVRKTFSNAQRAEQDVRERQANWNF*
Ga0137490_1000999Ga0137490_10009992F065820MEDDLKKGWEQLEEGLTKAMGKLSEAIEKAKAEMPDAMKGINEEYLRVQEMLDKAVDRLRK*
Ga0137490_1001950Ga0137490_10019503F056330MPVDALLSLQSTVTKTATFSGAALILPGGTPRRGLKARVFYSAAANATGANAVQFSIDVSYDGGVTWNSDFLAPALNLTTTAQAGELAIPFEVSPTSVVNQIQIRLTSLFGGAGTVPTVTYSSDGVMLSRP*
Ga0137490_1002903Ga0137490_10029031F087644LKSAWRETGYSPIGIVFDRSPATPDKLPFPTWKVSADWMEKGTFIEMMTPREMPKAVSLSISSHPAITRESENEALARDPIKGAMFLHPNGARRLTGMRVVAPNADRFPPAATYVAGLGLVKFDVGCQWLLDVTRDNGKQGVTKDLEPNLPLVIHY*
Ga0137490_1003415Ga0137490_10034152F042189VAELYEVLLIDGGARWHVGWLVDDETETDLLLTDSGKVLLFGSRAALEHHAQEHRLALNDDLPDEVDLDLGGWLSEGAPEPSTAEVSELWHLLYDDPMAGGVLETEELGEAYDDLVEDVDDWFAQHGEAARRALASAVSRLRSAFRVV*
Ga0137490_1007086Ga0137490_10070861F008637MTTAGPSEPTSPSAAHAWSHRIRKVGGYIQLGFAAFWLFRGGLSVDGISGVALATAGVALSLIVLGYALRVTAGLGRRPSGPEAKRIERSVNAATILELLASFAFPLIVIAAGHSDWVLPSIAVTIGPLLLWLDHLVDLPRFRPVGWALTVLPFVLIAVLSGSTLAAVTGLGAGALLLLTAAAGFHDLATLRPSTTHGAGRSRSRPRTT*
Ga0137490_1010835Ga0137490_10108353F061998MTGLEKGVTAFLAGLIAVALATTLVGPGKQTPAVINSAGGAVSGSLLAAQGSH*
Ga0137490_1014330Ga0137490_10143303F023385LRVIFNARRKTGRLDLEAIEMAVRSAMHQAGAAALTQLLQFAAPAADQRSIPCPCGQPAHYRELRAKALLTAVGKAEVSRPYYLCSHCHTG
Ga0137490_1018136Ga0137490_10181362F086028MSESFDLELAAAQLRADSADVRILVKVLVDQLSDALGPRLQVERSGGRFRKSEKIKAITITMEDDQFDAVVDGSVLRCTIGHSSGGIRIRSEKVDMDAWLNRLIAVLKSEADHSQAVRQA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.