NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059715

Metagenome / Metatranscriptome Family F059715

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059715
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 41 residues
Representative Sequence MDLDFNDLIDMLDGEEFDERPVDLRTFVTSPEYLGLPPLS
Number of Associated Samples 105
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 96.24 %
% of genes near scaffold ends (potentially truncated) 99.25 %
% of genes from short scaffolds (< 2000 bps) 87.97 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (83.459 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater
(14.286 % of family members)
Environment Ontology (ENVO) Unclassified
(45.865 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(60.150 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.94%    β-sheet: 0.00%    Coil/Unstructured: 72.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF13384HTH_23 6.77
PF02075RuvC 5.26
PF136402OG-FeII_Oxy_3 4.51
PF08241Methyltransf_11 2.26
PF05050Methyltransf_21 2.26
PF00478IMPDH 0.75
PF04577Glyco_transf_61 0.75
PF13578Methyltransf_24 0.75
PF12705PDDEXK_1 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0817Holliday junction resolvasome RuvABC endonuclease subunit RuvCReplication, recombination and repair [L] 5.26


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.47 %
UnclassifiedrootN/A13.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035265000|ErSWdraf_F5BXKTZ02HORIUAll Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300001850|RCM37_1023463All Organisms → cellular organisms → Bacteria1949Open in IMG/M
3300002297|B570J29603_107410All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300002356|B570J29598_106030All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300003650|SLW30_108565All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300004112|Ga0065166_10014210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2224Open in IMG/M
3300005517|Ga0070374_10118515All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1378Open in IMG/M
3300005517|Ga0070374_10166159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1143Open in IMG/M
3300005583|Ga0049085_10168838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300005662|Ga0078894_10105811All Organisms → cellular organisms → Bacteria2488Open in IMG/M
3300005662|Ga0078894_10835658All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300005662|Ga0078894_11798910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300005941|Ga0070743_10002108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7531Open in IMG/M
3300006875|Ga0075473_10349764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300007363|Ga0075458_10016132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2381Open in IMG/M
3300007542|Ga0099846_1327047Not Available522Open in IMG/M
3300007555|Ga0102817_1092948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage662Open in IMG/M
3300007559|Ga0102828_1065402All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage859Open in IMG/M
3300007597|Ga0102919_1089373Not Available967Open in IMG/M
3300007603|Ga0102921_1134077All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage898Open in IMG/M
3300007603|Ga0102921_1187887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300007630|Ga0102903_1124154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M
3300007632|Ga0102894_1156059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300007644|Ga0102902_1193836All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300007661|Ga0102866_1206809Not Available506Open in IMG/M
3300007860|Ga0105735_1013305All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1397Open in IMG/M
3300007974|Ga0105747_1158485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300008107|Ga0114340_1173184All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300008107|Ga0114340_1185284All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
3300008113|Ga0114346_1132933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1089Open in IMG/M
3300008113|Ga0114346_1318221All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300008117|Ga0114351_1438592Not Available533Open in IMG/M
3300008119|Ga0114354_1265335Not Available541Open in IMG/M
3300008120|Ga0114355_1031424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2637Open in IMG/M
3300008261|Ga0114336_1288259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300008262|Ga0114337_1055894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3291Open in IMG/M
3300008262|Ga0114337_1287319Not Available599Open in IMG/M
3300008263|Ga0114349_1071255All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1609Open in IMG/M
3300008448|Ga0114876_1102267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1139Open in IMG/M
3300008448|Ga0114876_1120653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1006Open in IMG/M
3300008448|Ga0114876_1164097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage794Open in IMG/M
3300008962|Ga0104242_1074838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300009026|Ga0102829_1153568All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300009056|Ga0102860_1246319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300009159|Ga0114978_10679168Not Available589Open in IMG/M
3300009164|Ga0114975_10545115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300009180|Ga0114979_10731043All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300009184|Ga0114976_10316999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage831Open in IMG/M
3300009419|Ga0114982_1006156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4531Open in IMG/M
3300009419|Ga0114982_1150493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage719Open in IMG/M
3300010354|Ga0129333_10379925All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1253Open in IMG/M
3300010354|Ga0129333_11118322All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage657Open in IMG/M
3300010370|Ga0129336_10167922All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1261Open in IMG/M
3300012000|Ga0119951_1083777All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage799Open in IMG/M
3300013004|Ga0164293_11058264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300013295|Ga0170791_14887503All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1508Open in IMG/M
3300013372|Ga0177922_10935844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage791Open in IMG/M
3300014962|Ga0134315_1073438Not Available524Open in IMG/M
3300017766|Ga0181343_1163988All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay616Open in IMG/M
3300020083|Ga0194111_10594691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300020084|Ga0194110_10686760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay636Open in IMG/M
3300020172|Ga0211729_10399199All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1788Open in IMG/M
3300020172|Ga0211729_10584882All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage941Open in IMG/M
3300020172|Ga0211729_10958436All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300020490|Ga0208052_104883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1163Open in IMG/M
3300020519|Ga0208223_1041770Not Available548Open in IMG/M
3300020603|Ga0194126_10634836All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
3300021519|Ga0194048_10207584Not Available723Open in IMG/M
3300021962|Ga0222713_10406566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay836Open in IMG/M
3300022752|Ga0214917_10106032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1619Open in IMG/M
3300022752|Ga0214917_10430868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300023184|Ga0214919_10020867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7323Open in IMG/M
3300024346|Ga0244775_10201992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1667Open in IMG/M
3300024346|Ga0244775_10900359Not Available703Open in IMG/M
3300024346|Ga0244775_11368755Not Available545Open in IMG/M
3300024351|Ga0255141_1037387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage724Open in IMG/M
3300024500|Ga0255143_1041768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage754Open in IMG/M
3300024506|Ga0255168_1082552All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300024507|Ga0255176_1058792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300024513|Ga0255144_1003616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay2767Open in IMG/M
3300024570|Ga0255276_1141556All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300024865|Ga0256340_1014886All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1945Open in IMG/M
3300024865|Ga0256340_1045193All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1113Open in IMG/M
3300024866|Ga0255272_1126280Not Available636Open in IMG/M
3300026457|Ga0255160_1054644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage671Open in IMG/M
3300026478|Ga0255156_1009161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2011Open in IMG/M
3300026566|Ga0256334_1090033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage699Open in IMG/M
3300026569|Ga0255277_1126134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300026573|Ga0255269_1049207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1171Open in IMG/M
3300027114|Ga0208009_1065594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage642Open in IMG/M
3300027123|Ga0255090_1014224All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1488Open in IMG/M
3300027217|Ga0208928_1057388Not Available575Open in IMG/M
3300027314|Ga0208811_1009955All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2254Open in IMG/M
3300027335|Ga0255130_1036666All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay907Open in IMG/M
3300027416|Ga0207994_1017581All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1456Open in IMG/M
3300027494|Ga0255094_1055336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage715Open in IMG/M
3300027508|Ga0255072_1020288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1407Open in IMG/M
3300027508|Ga0255072_1067291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300027586|Ga0208966_1017583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2107Open in IMG/M
3300027644|Ga0209356_1033615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1668Open in IMG/M
3300027656|Ga0209357_1093521All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage861Open in IMG/M
3300027656|Ga0209357_1108312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage778Open in IMG/M
3300027656|Ga0209357_1149943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300027710|Ga0209599_10123293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage685Open in IMG/M
3300027769|Ga0209770_10244417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay697Open in IMG/M
3300027769|Ga0209770_10262730All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay666Open in IMG/M
3300027805|Ga0209229_10515836All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300027816|Ga0209990_10048661All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2174Open in IMG/M
3300027892|Ga0209550_10210807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1317Open in IMG/M
3300027892|Ga0209550_10459397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay774Open in IMG/M
3300027892|Ga0209550_10497628All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300028025|Ga0247723_1029724All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1736Open in IMG/M
3300031787|Ga0315900_10810737All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300031857|Ga0315909_10194261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1616Open in IMG/M
3300031857|Ga0315909_10630864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300031963|Ga0315901_10234061All Organisms → Viruses → Predicted Viral1564Open in IMG/M
3300032093|Ga0315902_10855235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300032116|Ga0315903_10294963All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1374Open in IMG/M
3300032116|Ga0315903_10654558All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage795Open in IMG/M
3300032116|Ga0315903_10978449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300033992|Ga0334992_0432945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay583Open in IMG/M
3300033992|Ga0334992_0447548Not Available570Open in IMG/M
3300034071|Ga0335028_0145106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1516Open in IMG/M
3300034112|Ga0335066_0077241All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2149Open in IMG/M
3300034118|Ga0335053_0500749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage717Open in IMG/M
3300034120|Ga0335056_0239284Not Available1029Open in IMG/M
3300034121|Ga0335058_0533233All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300034168|Ga0335061_0658496Not Available523Open in IMG/M
3300034200|Ga0335065_0028744All Organisms → Viruses → Predicted Viral3919Open in IMG/M
3300034200|Ga0335065_0325051Not Available964Open in IMG/M
3300034272|Ga0335049_0000982All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage19842Open in IMG/M
3300034280|Ga0334997_0716814All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300034523|Ga0310143_19335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater14.29%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake12.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater12.03%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine9.77%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton8.27%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater6.02%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.26%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.51%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.01%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.01%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface3.01%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.26%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.26%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.50%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.75%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.75%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.75%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.75%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.75%
Subglacial FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater0.75%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.75%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.75%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035265000Freshwater microbial communities from Swedish Lakes - surface of Lake ErkenEnvironmentalOpen in IMG/M
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300002297Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002356Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnionEnvironmentalOpen in IMG/M
3300003650Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filterEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007632Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3EnvironmentalOpen in IMG/M
3300007644Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02EnvironmentalOpen in IMG/M
3300007661Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008962Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300012000Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007AEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014962Surface water microbial communities from Bangladesh - BaraHaldiaSW0309EnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020490Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020519Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024351Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300024500Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300024506Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8dEnvironmentalOpen in IMG/M
3300024507Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8dEnvironmentalOpen in IMG/M
3300024513Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300024570Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024865Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024866Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026457Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300026478Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300026566Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026569Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027114Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)EnvironmentalOpen in IMG/M
3300027123Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300027217Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027314Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027335Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8dEnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027494Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8dEnvironmentalOpen in IMG/M
3300027508Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027656Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034523Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ErSWdraft_36741802035265000FreshwaterMSFDFSDLIDMLDGEEFDEKPVDLKTFVRTSRIPW
RCM37_102346363300001850Marine PlanktonMDLNFDDLIDILDGEEFDERPVDLKTFVTSPDYLALPPLSEYQYS
B570J29603_10741023300002297FreshwaterVDLNFDDLIDILDGEEFDEKPVDLRTFVRHPDYLGLPELSEHQYTLIEKS
B570J29598_10603013300002356FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTSPEYLGLPPLSEHQYTL
SLW30_10856533300003650Subglacial FreshwaterMALDFNFADIIDLLDGEEFEEKPVDLKTFVHDPKYLGLPAL
Ga0065166_1001421063300004112Freshwater LakeMQFDFSEFIDILDGDEFEEKPADLRTFVTSPDYLGLPPLSENQYTLI
Ga0070374_1011851513300005517Freshwater LakeMSFEFDDLIDMLDGEEFDEKPVDLRTFVNHPDYLG
Ga0070374_1016615943300005517Freshwater LakeMSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQY
Ga0049085_1016883813300005583Freshwater LenticMSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELS
Ga0078894_1010581113300005662Freshwater LakeMSLDFSEFIEILDGDEFEERPVDLETFVTSPDYLGLPPLSE
Ga0078894_1083565813300005662Freshwater LakeMSFEFADLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTL
Ga0078894_1179891023300005662Freshwater LakeMSFEFSDLIDILDGEEFEEKPVDLRTFVTNPNFLGLPPLSELQYTLIEKSSQVYKESTLKKLFG
Ga0070743_1000210813300005941EstuarineMSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDY
Ga0075473_1034976413300006875AqueousMQRKLVDLNFNDLIDILDGEEFDERPVDLRTFVTSP
Ga0075458_1001613213300007363AqueousMSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKSSQIY
Ga0099846_132704733300007542AqueousMELNFNDLIDILDGEEFDERPVDLRTFVTGKEYLGLPPLSEY
Ga0102817_109294823300007555EstuarineMSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLI
Ga0102828_106540213300007559EstuarineMSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDY
Ga0102919_108937333300007597EstuarineVSFDFSDLIDILDGEEFEEKPVDLRTFVNDPNYLGLPPLSDYQYTLIEKSSQ
Ga0102921_113407733300007603EstuarineMSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSD
Ga0102921_118788723300007603EstuarineMSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIE
Ga0102903_112415413300007630EstuarineMSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQ
Ga0102894_115605923300007632EstuarineMSFDFNDIIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIE
Ga0102902_119383623300007644EstuarineMSFDFNDIIDMLDGEEFDEKPVDLKTFVRSPEYLGLP
Ga0102866_120680913300007661EstuarineMSFDFSDLIDILDGEEFEEKPVDLRTFVNDPNYLGLPPL
Ga0105735_101330553300007860Estuary WaterMSFDFSDLIDILDGEEFEDKPVDLRTFVNDPNYLG
Ga0105747_115848523300007974Estuary WaterMSFDFSDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELS
Ga0114340_117318423300008107Freshwater, PlanktonVDLNFDDLIDILDGEEFEEKPVDLRTFVTSPEYLGLPPLSEYQ
Ga0114340_118528413300008107Freshwater, PlanktonMEFNFSDIIDMLDGEEFDEKPVDLRTFVKSPQYLG
Ga0114346_113293343300008113Freshwater, PlanktonMSFDFDDIIDMLDGEEFDEKPVDLRTFVNHPEYLGL
Ga0114346_131822123300008113Freshwater, PlanktonVDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLGLPPLSEHQHTLIE
Ga0114351_143859233300008117Freshwater, PlanktonMELNFNDLIDILDGEEFDERPVDLQTFVTSPDYLALPPLS
Ga0114354_126533523300008119Freshwater, PlanktonMSFDFSDLIDILDGEEFEERPVDLKTFVTSPEYLGLPPL
Ga0114355_103142453300008120Freshwater, PlanktonVDLDFNDLIDILDGEEFDEKPVDLRTFVTSPDYLGLPPL
Ga0114336_128825923300008261Freshwater, PlanktonVSFDFSDLIDILDGEEFEEKPVDLMEFVTSPKYLGLPPLSDLQYELIEKSS
Ga0114337_105589423300008262Freshwater, PlanktonMEFNFSDIIDMLDGEEFDEKPVDLRTFVKSPQYLGKKQH*
Ga0114337_128731933300008262Freshwater, PlanktonMSFNFTDLIDILDGEEFEERPVDLKTFVTSPNYLGLPTLSEY
Ga0114349_107125543300008263Freshwater, PlanktonVDLNFNDLIDMLDGEEFDERPVDLRTFVQSPEYLGLPPL
Ga0114876_110226743300008448Freshwater LakeMDLDFNDLIDMLDGEEFDERPVDLRTFVTSPDYLGLPPL
Ga0114876_112065313300008448Freshwater LakeMSFDFSDLIDMLDGEEFDEKPVDLRTFVNGPEYLGLP
Ga0114876_116409733300008448Freshwater LakeMDLDFNDLIDMLDGEEFDERPVDLRTFVTSPEYLG
Ga0104242_107483823300008962FreshwaterMSFDFNDLIDMLDGEEFDEKPVDLRTFVRSPEYLGLPELSDYQYTLIEK
Ga0102829_115356823300009026EstuarineMSFDFSDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLP
Ga0102860_124631923300009056EstuarineMSFEFTDLIDMLDGEEFDEKPVYLKTFVRSPEYLGLP
Ga0114978_1067916823300009159Freshwater LakeMSLDFSDFIEILDGDEFEEKPVDLQTFVTSPDYLGLPP
Ga0114975_1054511513300009164Freshwater LakeMSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGL
Ga0114979_1073104313300009180Freshwater LakeMSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKSSQ
Ga0114976_1031699933300009184Freshwater LakeVDLNFNDLIDILDGEEFEERPVDLRAFVTNPEYLGLP
Ga0114982_1006156103300009419Deep SubsurfaceMSFEFEDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPE
Ga0114982_115049313300009419Deep SubsurfaceMSFEFEDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQ
Ga0129333_1037992543300010354Freshwater To Marine Saline GradientMVVNLMDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLGL
Ga0129333_1111832223300010354Freshwater To Marine Saline GradientVDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLGL
Ga0129336_1016792233300010370Freshwater To Marine Saline GradientMDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLGLP
Ga0119951_108377713300012000FreshwaterVDLNFGDLIDLLDGEEFDEKPVDLKTFVNHPDYLGLP
Ga0164293_1105826423300013004FreshwaterMQVDFDFNDIIDMLDGEEFEERPVDLRTFVTSPAYLGLPPLSELQYT
Ga0170791_1488750343300013295FreshwaterVSFDFSDLIDILDGEEFEEKPVDLRTFVNDPNYLGLPLLSDYQYTL
Ga0177922_1093584433300013372FreshwaterMSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQ
Ga0134315_107343823300014962Surface WaterVDLNFDDFIDILDGEEFDERPVDLKTFIYDKNYLG
Ga0181343_116398823300017766Freshwater LakeMEFNFSDLIDLLDGEEFDEKPVDLRTFVNSPDYLGLPPLSEFQYTLIEKSSQI
Ga0194111_1059469113300020083Freshwater LakeVELNFNDLIDILDGEEFDERPVDLRTFVTGKEYLG
Ga0194110_1068676013300020084Freshwater LakeVGLDFSDLIDILDGEEFDERPIDLRTFVTSPEYLGLPELSEHQYTLIE
Ga0211729_1039919913300020172FreshwaterMDLNFNDLIDILDGEEFDERPVDLRTFVTSQEYLGLPPL
Ga0211729_1058488233300020172FreshwaterMSFEFEDLIDMLDGEEFDEKPVDLRTFVRSPEYLGL
Ga0211729_1095843613300020172FreshwaterMSFEFEDLIDMLDGEEFDEKPVDLRTFVRSPEYLGLPELS
Ga0208052_10488313300020490FreshwaterMSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKSSQI
Ga0208223_104177013300020519FreshwaterMSFNFSDIIDILDNEEFEERPVDLQTFVTNPNYLALPPLSNYQ
Ga0194126_1063483623300020603Freshwater LakeVGLDFSDLIDILDGEEFDERPIDLRTFVTSPEYLGL
Ga0194048_1020758423300021519Anoxic Zone FreshwaterMSFDFSDLIDILDGEEFEEKPVDLRTFVNDPKYLGLPPLSEY
Ga0222713_1040656613300021962Estuarine WaterMSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKSSQIY
Ga0214917_1010603243300022752FreshwaterMSFEFGDLIDLLDGEEFDEKPVQLEEFVTSPKYLALPPLSELQ
Ga0214917_1043086813300022752FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTSPNYLGLPPLSEHQYTLIE
Ga0214919_10020867173300023184FreshwaterMSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTL
Ga0244775_1020199243300024346EstuarineVDLDFNDLIDILDGEEFDERPVDLRTFVTSPAYLG
Ga0244775_1090035923300024346EstuarineVEFDFNDLIDILDGEEFDERPVDLRTFVTDKNYLGLPDLSE
Ga0244775_1136875523300024346EstuarineMEFDFSNLIDILDGEEFDERPVDLKTFVQSPDYLGLPPLSEYQ
Ga0255141_103738723300024351FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLALPP
Ga0255143_104176813300024500FreshwaterMRSLVDLNFNDLIDILDGEEFDERPVDLRTFVTGKDYLGLPELS
Ga0255168_108255213300024506FreshwaterMQRKQVDLNFNDLIDILDGEEFDERPVDLKTFVTSPDYLGLPPLSE
Ga0255176_105879213300024507FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLGLPPLS
Ga0255144_100361613300024513FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLAL
Ga0255276_114155613300024570FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTSPNYLGLPPLSE
Ga0256340_101488663300024865FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTSPNYLGLPPLSEH
Ga0256340_104519313300024865FreshwaterVELNFNDLIDILDGEEFDEKPVDLKTFVTHPDYLGLPP
Ga0255272_112628023300024866FreshwaterMLDFNDIIDMLDGEEFDERPVDLAKFVTSEDYLGLP
Ga0255160_105464423300026457FreshwaterMQRKQVDLNFNDLIDILDGEEFDERPVDLKTFVTSPDYLGLPPLSENQYTL
Ga0255156_100916163300026478FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLALP
Ga0256334_109003313300026566FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLGLP
Ga0255277_112613413300026569FreshwaterMQRKLVDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLYKY
Ga0255269_104920713300026573FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTGQDYLALPPLSEHQYTLIEK
Ga0208009_106559423300027114Deep SubsurfaceVDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLG
Ga0255090_101422413300027123FreshwaterVDLNFDDLIDILDGEEFDERPVDLKTFVTSPDYLGLPPLSDYQYT
Ga0208928_105738823300027217EstuarineMSFDFSDLIDILDGEEFEEKPVDLRTFVNDPNYLGLP
Ga0208811_100995513300027314EstuarineMSFDFSDLIDILDGEEFEEKPVDLRTFVNDPNYLGLPPLS
Ga0255130_103666613300027335FreshwaterMSFDFADLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQY
Ga0207994_101758143300027416EstuarineMSFDFSDLIDILDGEEFEEKPVDLRTFVNHPNFLGLPPLSEY
Ga0255094_105533613300027494FreshwaterVDLNFDDLIDILDGEEFDERPVDLRTFVTSPDYLGLPPLSDYQ
Ga0255072_102028813300027508FreshwaterMSFDFSDLIDILDGEEFEEKPVDLRTFVNDPKYLGLPPLSEYQ
Ga0255072_106729113300027508FreshwaterMSFEFGDLIDLLDGEEFDEKPVQLEEFVTSPRYLALPPLSELQY
Ga0208966_101758313300027586Freshwater LenticMSFNFSDLIDILDGEEFEEKPVDLRTFVNDPKYLGLPPL
Ga0209356_103361513300027644Freshwater LakeMSFDYADLIDMLDGEEFDEKPVDLKTFATHSDYLG
Ga0209357_109352133300027656Freshwater LakeMSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPEL
Ga0209357_110831213300027656Freshwater LakeMSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPEL
Ga0209357_114994313300027656Freshwater LakeMSFDFSDIIDMLDGEEFDEKPVSLRDFVTNEKYLGLPE
Ga0209599_1012329313300027710Deep SubsurfaceMSFEFEDLIDMLDGEEFDEKPVDLKTFVRSPEYLG
Ga0209770_1024441723300027769Freshwater LakeMSFEFEDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKS
Ga0209770_1026273023300027769Freshwater LakeMSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLI
Ga0209229_1051583623300027805Freshwater And SedimentVDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLGLPPLSEY
Ga0209990_1004866113300027816Freshwater LakeMSVEFSFDDLIDILDGEEFEERPVDLQTFVTSPDYLGLPPLSELQYTLIEKSS
Ga0209550_1021080713300027892Freshwater LakeMSFNFSDIIDILDGEEFEERPVELDEFVVSNEYLGLPPL
Ga0209550_1045939723300027892Freshwater LakeMSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKSSQ
Ga0209550_1049762813300027892Freshwater LakeMSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELS
Ga0247723_102972413300028025Deep Subsurface SedimentVDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLG
Ga0315900_1081073713300031787FreshwaterMDLDFNDLIDMLDGEEFDERPVDLRTFVTSPEYLGLPPLS
Ga0315909_1019426153300031857FreshwaterMDLDFNDLIDMLDGEEFDERPVDLRTFVTSPEYLGL
Ga0315909_1063086413300031857FreshwaterMDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLG
Ga0315901_1023406113300031963FreshwaterMSFDFEDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQY
Ga0315902_1085523513300032093FreshwaterMQVDLNFNDIIDILDGEEFDEKPVDLKTFVTSPDYLGLPPLSE
Ga0315903_1029496313300032116FreshwaterVDLNFNDLIDILDGEEFDERPVDLRTFVTGQDYLA
Ga0315903_1065455833300032116FreshwaterMQRKQVDLDFNDLIDILDGEEFDEKPVDLRTFVTSPDYLGLPP
Ga0315903_1097844913300032116FreshwaterMQRKLVDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYL
Ga0334992_0432945_1_1593300033992FreshwaterMSFNFSDLIDILDGEEFDEKPVDLKTFVNSPEYLGLPPLSEFQYTLIEKSSQI
Ga0334992_0447548_3_1103300033992FreshwaterMSVDFNFDDLIDMLDGEEFDERPVDLRTFVTDPQFL
Ga0335028_0145106_2_1123300034071FreshwaterMDLNFNDLIDILDGEEFEERPVDLQTFVTSPNYLALP
Ga0335066_0077241_3_1343300034112FreshwaterMDLNFNDLIDILDGEEFDERPVDLRTFVTSPEYLGLPPLSEHQY
Ga0335053_0500749_605_7153300034118FreshwaterMDLNFNDLIDILDGEEFDERPVDLITFVTSPDYLGLP
Ga0335056_0239284_870_10283300034120FreshwaterMSFNFSDIIDILDNEEFEERPVDLQTFVTNPNYLALPPLSNYQYTLIEKSSQI
Ga0335058_0533233_2_1273300034121FreshwaterMSFDFSDIIDMLDGEEFDEKPVSLRDFVTNEKYLGLPELSEY
Ga0335061_0658496_405_5213300034168FreshwaterMSFDFSDIIDMLDGEEFDEKPVSLRDFVTDEKYLGLPEL
Ga0335065_0028744_3779_39193300034200FreshwaterMSFDFADLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLI
Ga0335065_0325051_856_9633300034200FreshwaterMSFNFSDIIDILDNEEFEERPVDLQTFVTSPNYLAL
Ga0335049_0000982_1_1113300034272FreshwaterMSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLP
Ga0334997_0716814_480_6083300034280FreshwaterMDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLGLPPLSEYQ
Ga0310143_19335_3_1253300034523Fracking WaterMDLNFNDLIDILDGEEFEERPVDLRTFVTSPEYLGLPPLSE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.