Basic Information | |
---|---|
Family ID | F059715 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 133 |
Average Sequence Length | 41 residues |
Representative Sequence | MDLDFNDLIDMLDGEEFDERPVDLRTFVTSPEYLGLPPLS |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 96.24 % |
% of genes near scaffold ends (potentially truncated) | 99.25 % |
% of genes from short scaffolds (< 2000 bps) | 87.97 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (83.459 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (14.286 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.865 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.150 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.94% β-sheet: 0.00% Coil/Unstructured: 72.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF13384 | HTH_23 | 6.77 |
PF02075 | RuvC | 5.26 |
PF13640 | 2OG-FeII_Oxy_3 | 4.51 |
PF08241 | Methyltransf_11 | 2.26 |
PF05050 | Methyltransf_21 | 2.26 |
PF00478 | IMPDH | 0.75 |
PF04577 | Glyco_transf_61 | 0.75 |
PF13578 | Methyltransf_24 | 0.75 |
PF12705 | PDDEXK_1 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 5.26 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.47 % |
Unclassified | root | N/A | 13.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035265000|ErSWdraf_F5BXKTZ02HORIU | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300001850|RCM37_1023463 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
3300002297|B570J29603_107410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300002356|B570J29598_106030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300003650|SLW30_108565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300004112|Ga0065166_10014210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2224 | Open in IMG/M |
3300005517|Ga0070374_10118515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1378 | Open in IMG/M |
3300005517|Ga0070374_10166159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
3300005583|Ga0049085_10168838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300005662|Ga0078894_10105811 | All Organisms → cellular organisms → Bacteria | 2488 | Open in IMG/M |
3300005662|Ga0078894_10835658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
3300005662|Ga0078894_11798910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300005941|Ga0070743_10002108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7531 | Open in IMG/M |
3300006875|Ga0075473_10349764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300007363|Ga0075458_10016132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2381 | Open in IMG/M |
3300007542|Ga0099846_1327047 | Not Available | 522 | Open in IMG/M |
3300007555|Ga0102817_1092948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300007559|Ga0102828_1065402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300007597|Ga0102919_1089373 | Not Available | 967 | Open in IMG/M |
3300007603|Ga0102921_1134077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300007603|Ga0102921_1187887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300007630|Ga0102903_1124154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300007632|Ga0102894_1156059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300007644|Ga0102902_1193836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300007661|Ga0102866_1206809 | Not Available | 506 | Open in IMG/M |
3300007860|Ga0105735_1013305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1397 | Open in IMG/M |
3300007974|Ga0105747_1158485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300008107|Ga0114340_1173184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300008107|Ga0114340_1185284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300008113|Ga0114346_1132933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1089 | Open in IMG/M |
3300008113|Ga0114346_1318221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300008117|Ga0114351_1438592 | Not Available | 533 | Open in IMG/M |
3300008119|Ga0114354_1265335 | Not Available | 541 | Open in IMG/M |
3300008120|Ga0114355_1031424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2637 | Open in IMG/M |
3300008261|Ga0114336_1288259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300008262|Ga0114337_1055894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3291 | Open in IMG/M |
3300008262|Ga0114337_1287319 | Not Available | 599 | Open in IMG/M |
3300008263|Ga0114349_1071255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1609 | Open in IMG/M |
3300008448|Ga0114876_1102267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
3300008448|Ga0114876_1120653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
3300008448|Ga0114876_1164097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300008962|Ga0104242_1074838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300009026|Ga0102829_1153568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300009056|Ga0102860_1246319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300009159|Ga0114978_10679168 | Not Available | 589 | Open in IMG/M |
3300009164|Ga0114975_10545115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300009180|Ga0114979_10731043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300009184|Ga0114976_10316999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
3300009419|Ga0114982_1006156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4531 | Open in IMG/M |
3300009419|Ga0114982_1150493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300010354|Ga0129333_10379925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1253 | Open in IMG/M |
3300010354|Ga0129333_11118322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300010370|Ga0129336_10167922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1261 | Open in IMG/M |
3300012000|Ga0119951_1083777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300013004|Ga0164293_11058264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300013295|Ga0170791_14887503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1508 | Open in IMG/M |
3300013372|Ga0177922_10935844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300014962|Ga0134315_1073438 | Not Available | 524 | Open in IMG/M |
3300017766|Ga0181343_1163988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 616 | Open in IMG/M |
3300020083|Ga0194111_10594691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300020084|Ga0194110_10686760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 636 | Open in IMG/M |
3300020172|Ga0211729_10399199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1788 | Open in IMG/M |
3300020172|Ga0211729_10584882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300020172|Ga0211729_10958436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300020490|Ga0208052_104883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1163 | Open in IMG/M |
3300020519|Ga0208223_1041770 | Not Available | 548 | Open in IMG/M |
3300020603|Ga0194126_10634836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300021519|Ga0194048_10207584 | Not Available | 723 | Open in IMG/M |
3300021962|Ga0222713_10406566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 836 | Open in IMG/M |
3300022752|Ga0214917_10106032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1619 | Open in IMG/M |
3300022752|Ga0214917_10430868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300023184|Ga0214919_10020867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7323 | Open in IMG/M |
3300024346|Ga0244775_10201992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1667 | Open in IMG/M |
3300024346|Ga0244775_10900359 | Not Available | 703 | Open in IMG/M |
3300024346|Ga0244775_11368755 | Not Available | 545 | Open in IMG/M |
3300024351|Ga0255141_1037387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300024500|Ga0255143_1041768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300024506|Ga0255168_1082552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300024507|Ga0255176_1058792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300024513|Ga0255144_1003616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 2767 | Open in IMG/M |
3300024570|Ga0255276_1141556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300024865|Ga0256340_1014886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1945 | Open in IMG/M |
3300024865|Ga0256340_1045193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300024866|Ga0255272_1126280 | Not Available | 636 | Open in IMG/M |
3300026457|Ga0255160_1054644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300026478|Ga0255156_1009161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2011 | Open in IMG/M |
3300026566|Ga0256334_1090033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
3300026569|Ga0255277_1126134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300026573|Ga0255269_1049207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1171 | Open in IMG/M |
3300027114|Ga0208009_1065594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300027123|Ga0255090_1014224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1488 | Open in IMG/M |
3300027217|Ga0208928_1057388 | Not Available | 575 | Open in IMG/M |
3300027314|Ga0208811_1009955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2254 | Open in IMG/M |
3300027335|Ga0255130_1036666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 907 | Open in IMG/M |
3300027416|Ga0207994_1017581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1456 | Open in IMG/M |
3300027494|Ga0255094_1055336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300027508|Ga0255072_1020288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1407 | Open in IMG/M |
3300027508|Ga0255072_1067291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300027586|Ga0208966_1017583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2107 | Open in IMG/M |
3300027644|Ga0209356_1033615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1668 | Open in IMG/M |
3300027656|Ga0209357_1093521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300027656|Ga0209357_1108312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300027656|Ga0209357_1149943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300027710|Ga0209599_10123293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300027769|Ga0209770_10244417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 697 | Open in IMG/M |
3300027769|Ga0209770_10262730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 666 | Open in IMG/M |
3300027805|Ga0209229_10515836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300027816|Ga0209990_10048661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2174 | Open in IMG/M |
3300027892|Ga0209550_10210807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1317 | Open in IMG/M |
3300027892|Ga0209550_10459397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 774 | Open in IMG/M |
3300027892|Ga0209550_10497628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300028025|Ga0247723_1029724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1736 | Open in IMG/M |
3300031787|Ga0315900_10810737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300031857|Ga0315909_10194261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1616 | Open in IMG/M |
3300031857|Ga0315909_10630864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300031963|Ga0315901_10234061 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
3300032093|Ga0315902_10855235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300032116|Ga0315903_10294963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1374 | Open in IMG/M |
3300032116|Ga0315903_10654558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300032116|Ga0315903_10978449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300033992|Ga0334992_0432945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 583 | Open in IMG/M |
3300033992|Ga0334992_0447548 | Not Available | 570 | Open in IMG/M |
3300034071|Ga0335028_0145106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1516 | Open in IMG/M |
3300034112|Ga0335066_0077241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2149 | Open in IMG/M |
3300034118|Ga0335053_0500749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300034120|Ga0335056_0239284 | Not Available | 1029 | Open in IMG/M |
3300034121|Ga0335058_0533233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300034168|Ga0335061_0658496 | Not Available | 523 | Open in IMG/M |
3300034200|Ga0335065_0028744 | All Organisms → Viruses → Predicted Viral | 3919 | Open in IMG/M |
3300034200|Ga0335065_0325051 | Not Available | 964 | Open in IMG/M |
3300034272|Ga0335049_0000982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19842 | Open in IMG/M |
3300034280|Ga0334997_0716814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300034523|Ga0310143_19335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 14.29% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.03% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 9.77% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.27% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.02% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.26% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.51% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.01% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.01% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.01% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.26% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.26% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.50% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.50% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.75% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.75% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.75% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.75% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.75% |
Subglacial Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater | 0.75% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.75% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.75% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300002297 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002356 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300003650 | Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filter | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020490 | Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300027217 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027314 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027335 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300027416 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes) | Environmental | Open in IMG/M |
3300027494 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d | Environmental | Open in IMG/M |
3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
3300034523 | Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ErSWdraft_3674180 | 2035265000 | Freshwater | MSFDFSDLIDMLDGEEFDEKPVDLKTFVRTSRIPW |
RCM37_10234636 | 3300001850 | Marine Plankton | MDLNFDDLIDILDGEEFDERPVDLKTFVTSPDYLALPPLSEYQYS |
B570J29603_1074102 | 3300002297 | Freshwater | VDLNFDDLIDILDGEEFDEKPVDLRTFVRHPDYLGLPELSEHQYTLIEKS |
B570J29598_1060301 | 3300002356 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTSPEYLGLPPLSEHQYTL |
SLW30_1085653 | 3300003650 | Subglacial Freshwater | MALDFNFADIIDLLDGEEFEEKPVDLKTFVHDPKYLGLPAL |
Ga0065166_100142106 | 3300004112 | Freshwater Lake | MQFDFSEFIDILDGDEFEEKPADLRTFVTSPDYLGLPPLSENQYTLI |
Ga0070374_101185151 | 3300005517 | Freshwater Lake | MSFEFDDLIDMLDGEEFDEKPVDLRTFVNHPDYLG |
Ga0070374_101661594 | 3300005517 | Freshwater Lake | MSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQY |
Ga0049085_101688381 | 3300005583 | Freshwater Lentic | MSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELS |
Ga0078894_101058111 | 3300005662 | Freshwater Lake | MSLDFSEFIEILDGDEFEERPVDLETFVTSPDYLGLPPLSE |
Ga0078894_108356581 | 3300005662 | Freshwater Lake | MSFEFADLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTL |
Ga0078894_117989102 | 3300005662 | Freshwater Lake | MSFEFSDLIDILDGEEFEEKPVDLRTFVTNPNFLGLPPLSELQYTLIEKSSQVYKESTLKKLFG |
Ga0070743_100021081 | 3300005941 | Estuarine | MSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDY |
Ga0075473_103497641 | 3300006875 | Aqueous | MQRKLVDLNFNDLIDILDGEEFDERPVDLRTFVTSP |
Ga0075458_100161321 | 3300007363 | Aqueous | MSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKSSQIY |
Ga0099846_13270473 | 3300007542 | Aqueous | MELNFNDLIDILDGEEFDERPVDLRTFVTGKEYLGLPPLSEY |
Ga0102817_10929482 | 3300007555 | Estuarine | MSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLI |
Ga0102828_10654021 | 3300007559 | Estuarine | MSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDY |
Ga0102919_10893733 | 3300007597 | Estuarine | VSFDFSDLIDILDGEEFEEKPVDLRTFVNDPNYLGLPPLSDYQYTLIEKSSQ |
Ga0102921_11340773 | 3300007603 | Estuarine | MSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSD |
Ga0102921_11878872 | 3300007603 | Estuarine | MSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIE |
Ga0102903_11241541 | 3300007630 | Estuarine | MSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQ |
Ga0102894_11560592 | 3300007632 | Estuarine | MSFDFNDIIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIE |
Ga0102902_11938362 | 3300007644 | Estuarine | MSFDFNDIIDMLDGEEFDEKPVDLKTFVRSPEYLGLP |
Ga0102866_12068091 | 3300007661 | Estuarine | MSFDFSDLIDILDGEEFEEKPVDLRTFVNDPNYLGLPPL |
Ga0105735_10133055 | 3300007860 | Estuary Water | MSFDFSDLIDILDGEEFEDKPVDLRTFVNDPNYLG |
Ga0105747_11584852 | 3300007974 | Estuary Water | MSFDFSDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELS |
Ga0114340_11731842 | 3300008107 | Freshwater, Plankton | VDLNFDDLIDILDGEEFEEKPVDLRTFVTSPEYLGLPPLSEYQ |
Ga0114340_11852841 | 3300008107 | Freshwater, Plankton | MEFNFSDIIDMLDGEEFDEKPVDLRTFVKSPQYLG |
Ga0114346_11329334 | 3300008113 | Freshwater, Plankton | MSFDFDDIIDMLDGEEFDEKPVDLRTFVNHPEYLGL |
Ga0114346_13182212 | 3300008113 | Freshwater, Plankton | VDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLGLPPLSEHQHTLIE |
Ga0114351_14385923 | 3300008117 | Freshwater, Plankton | MELNFNDLIDILDGEEFDERPVDLQTFVTSPDYLALPPLS |
Ga0114354_12653352 | 3300008119 | Freshwater, Plankton | MSFDFSDLIDILDGEEFEERPVDLKTFVTSPEYLGLPPL |
Ga0114355_10314245 | 3300008120 | Freshwater, Plankton | VDLDFNDLIDILDGEEFDEKPVDLRTFVTSPDYLGLPPL |
Ga0114336_12882592 | 3300008261 | Freshwater, Plankton | VSFDFSDLIDILDGEEFEEKPVDLMEFVTSPKYLGLPPLSDLQYELIEKSS |
Ga0114337_10558942 | 3300008262 | Freshwater, Plankton | MEFNFSDIIDMLDGEEFDEKPVDLRTFVKSPQYLGKKQH* |
Ga0114337_12873193 | 3300008262 | Freshwater, Plankton | MSFNFTDLIDILDGEEFEERPVDLKTFVTSPNYLGLPTLSEY |
Ga0114349_10712554 | 3300008263 | Freshwater, Plankton | VDLNFNDLIDMLDGEEFDERPVDLRTFVQSPEYLGLPPL |
Ga0114876_11022674 | 3300008448 | Freshwater Lake | MDLDFNDLIDMLDGEEFDERPVDLRTFVTSPDYLGLPPL |
Ga0114876_11206531 | 3300008448 | Freshwater Lake | MSFDFSDLIDMLDGEEFDEKPVDLRTFVNGPEYLGLP |
Ga0114876_11640973 | 3300008448 | Freshwater Lake | MDLDFNDLIDMLDGEEFDERPVDLRTFVTSPEYLG |
Ga0104242_10748382 | 3300008962 | Freshwater | MSFDFNDLIDMLDGEEFDEKPVDLRTFVRSPEYLGLPELSDYQYTLIEK |
Ga0102829_11535682 | 3300009026 | Estuarine | MSFDFSDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLP |
Ga0102860_12463192 | 3300009056 | Estuarine | MSFEFTDLIDMLDGEEFDEKPVYLKTFVRSPEYLGLP |
Ga0114978_106791682 | 3300009159 | Freshwater Lake | MSLDFSDFIEILDGDEFEEKPVDLQTFVTSPDYLGLPP |
Ga0114975_105451151 | 3300009164 | Freshwater Lake | MSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGL |
Ga0114979_107310431 | 3300009180 | Freshwater Lake | MSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKSSQ |
Ga0114976_103169993 | 3300009184 | Freshwater Lake | VDLNFNDLIDILDGEEFEERPVDLRAFVTNPEYLGLP |
Ga0114982_100615610 | 3300009419 | Deep Subsurface | MSFEFEDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPE |
Ga0114982_11504931 | 3300009419 | Deep Subsurface | MSFEFEDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQ |
Ga0129333_103799254 | 3300010354 | Freshwater To Marine Saline Gradient | MVVNLMDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLGL |
Ga0129333_111183222 | 3300010354 | Freshwater To Marine Saline Gradient | VDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLGL |
Ga0129336_101679223 | 3300010370 | Freshwater To Marine Saline Gradient | MDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLGLP |
Ga0119951_10837771 | 3300012000 | Freshwater | VDLNFGDLIDLLDGEEFDEKPVDLKTFVNHPDYLGLP |
Ga0164293_110582642 | 3300013004 | Freshwater | MQVDFDFNDIIDMLDGEEFEERPVDLRTFVTSPAYLGLPPLSELQYT |
Ga0170791_148875034 | 3300013295 | Freshwater | VSFDFSDLIDILDGEEFEEKPVDLRTFVNDPNYLGLPLLSDYQYTL |
Ga0177922_109358443 | 3300013372 | Freshwater | MSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQ |
Ga0134315_10734382 | 3300014962 | Surface Water | VDLNFDDFIDILDGEEFDERPVDLKTFIYDKNYLG |
Ga0181343_11639882 | 3300017766 | Freshwater Lake | MEFNFSDLIDLLDGEEFDEKPVDLRTFVNSPDYLGLPPLSEFQYTLIEKSSQI |
Ga0194111_105946911 | 3300020083 | Freshwater Lake | VELNFNDLIDILDGEEFDERPVDLRTFVTGKEYLG |
Ga0194110_106867601 | 3300020084 | Freshwater Lake | VGLDFSDLIDILDGEEFDERPIDLRTFVTSPEYLGLPELSEHQYTLIE |
Ga0211729_103991991 | 3300020172 | Freshwater | MDLNFNDLIDILDGEEFDERPVDLRTFVTSQEYLGLPPL |
Ga0211729_105848823 | 3300020172 | Freshwater | MSFEFEDLIDMLDGEEFDEKPVDLRTFVRSPEYLGL |
Ga0211729_109584361 | 3300020172 | Freshwater | MSFEFEDLIDMLDGEEFDEKPVDLRTFVRSPEYLGLPELS |
Ga0208052_1048831 | 3300020490 | Freshwater | MSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKSSQI |
Ga0208223_10417701 | 3300020519 | Freshwater | MSFNFSDIIDILDNEEFEERPVDLQTFVTNPNYLALPPLSNYQ |
Ga0194126_106348362 | 3300020603 | Freshwater Lake | VGLDFSDLIDILDGEEFDERPIDLRTFVTSPEYLGL |
Ga0194048_102075842 | 3300021519 | Anoxic Zone Freshwater | MSFDFSDLIDILDGEEFEEKPVDLRTFVNDPKYLGLPPLSEY |
Ga0222713_104065661 | 3300021962 | Estuarine Water | MSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKSSQIY |
Ga0214917_101060324 | 3300022752 | Freshwater | MSFEFGDLIDLLDGEEFDEKPVQLEEFVTSPKYLALPPLSELQ |
Ga0214917_104308681 | 3300022752 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTSPNYLGLPPLSEHQYTLIE |
Ga0214919_1002086717 | 3300023184 | Freshwater | MSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTL |
Ga0244775_102019924 | 3300024346 | Estuarine | VDLDFNDLIDILDGEEFDERPVDLRTFVTSPAYLG |
Ga0244775_109003592 | 3300024346 | Estuarine | VEFDFNDLIDILDGEEFDERPVDLRTFVTDKNYLGLPDLSE |
Ga0244775_113687552 | 3300024346 | Estuarine | MEFDFSNLIDILDGEEFDERPVDLKTFVQSPDYLGLPPLSEYQ |
Ga0255141_10373872 | 3300024351 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLALPP |
Ga0255143_10417681 | 3300024500 | Freshwater | MRSLVDLNFNDLIDILDGEEFDERPVDLRTFVTGKDYLGLPELS |
Ga0255168_10825521 | 3300024506 | Freshwater | MQRKQVDLNFNDLIDILDGEEFDERPVDLKTFVTSPDYLGLPPLSE |
Ga0255176_10587921 | 3300024507 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLGLPPLS |
Ga0255144_10036161 | 3300024513 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLAL |
Ga0255276_11415561 | 3300024570 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTSPNYLGLPPLSE |
Ga0256340_10148866 | 3300024865 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTSPNYLGLPPLSEH |
Ga0256340_10451931 | 3300024865 | Freshwater | VELNFNDLIDILDGEEFDEKPVDLKTFVTHPDYLGLPP |
Ga0255272_11262802 | 3300024866 | Freshwater | MLDFNDIIDMLDGEEFDERPVDLAKFVTSEDYLGLP |
Ga0255160_10546442 | 3300026457 | Freshwater | MQRKQVDLNFNDLIDILDGEEFDERPVDLKTFVTSPDYLGLPPLSENQYTL |
Ga0255156_10091616 | 3300026478 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLALP |
Ga0256334_10900331 | 3300026566 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLGLP |
Ga0255277_11261341 | 3300026569 | Freshwater | MQRKLVDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLYKY |
Ga0255269_10492071 | 3300026573 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTGQDYLALPPLSEHQYTLIEK |
Ga0208009_10655942 | 3300027114 | Deep Subsurface | VDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLG |
Ga0255090_10142241 | 3300027123 | Freshwater | VDLNFDDLIDILDGEEFDERPVDLKTFVTSPDYLGLPPLSDYQYT |
Ga0208928_10573882 | 3300027217 | Estuarine | MSFDFSDLIDILDGEEFEEKPVDLRTFVNDPNYLGLP |
Ga0208811_10099551 | 3300027314 | Estuarine | MSFDFSDLIDILDGEEFEEKPVDLRTFVNDPNYLGLPPLS |
Ga0255130_10366661 | 3300027335 | Freshwater | MSFDFADLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQY |
Ga0207994_10175814 | 3300027416 | Estuarine | MSFDFSDLIDILDGEEFEEKPVDLRTFVNHPNFLGLPPLSEY |
Ga0255094_10553361 | 3300027494 | Freshwater | VDLNFDDLIDILDGEEFDERPVDLRTFVTSPDYLGLPPLSDYQ |
Ga0255072_10202881 | 3300027508 | Freshwater | MSFDFSDLIDILDGEEFEEKPVDLRTFVNDPKYLGLPPLSEYQ |
Ga0255072_10672911 | 3300027508 | Freshwater | MSFEFGDLIDLLDGEEFDEKPVQLEEFVTSPRYLALPPLSELQY |
Ga0208966_10175831 | 3300027586 | Freshwater Lentic | MSFNFSDLIDILDGEEFEEKPVDLRTFVNDPKYLGLPPL |
Ga0209356_10336151 | 3300027644 | Freshwater Lake | MSFDYADLIDMLDGEEFDEKPVDLKTFATHSDYLG |
Ga0209357_10935213 | 3300027656 | Freshwater Lake | MSFDFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPEL |
Ga0209357_11083121 | 3300027656 | Freshwater Lake | MSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPEL |
Ga0209357_11499431 | 3300027656 | Freshwater Lake | MSFDFSDIIDMLDGEEFDEKPVSLRDFVTNEKYLGLPE |
Ga0209599_101232931 | 3300027710 | Deep Subsurface | MSFEFEDLIDMLDGEEFDEKPVDLKTFVRSPEYLG |
Ga0209770_102444172 | 3300027769 | Freshwater Lake | MSFEFEDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKS |
Ga0209770_102627302 | 3300027769 | Freshwater Lake | MSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLI |
Ga0209229_105158362 | 3300027805 | Freshwater And Sediment | VDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLGLPPLSEY |
Ga0209990_100486611 | 3300027816 | Freshwater Lake | MSVEFSFDDLIDILDGEEFEERPVDLQTFVTSPDYLGLPPLSELQYTLIEKSS |
Ga0209550_102108071 | 3300027892 | Freshwater Lake | MSFNFSDIIDILDGEEFEERPVELDEFVVSNEYLGLPPL |
Ga0209550_104593972 | 3300027892 | Freshwater Lake | MSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLIEKSSQ |
Ga0209550_104976281 | 3300027892 | Freshwater Lake | MSFDFNDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELS |
Ga0247723_10297241 | 3300028025 | Deep Subsurface Sediment | VDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYLG |
Ga0315900_108107371 | 3300031787 | Freshwater | MDLDFNDLIDMLDGEEFDERPVDLRTFVTSPEYLGLPPLS |
Ga0315909_101942615 | 3300031857 | Freshwater | MDLDFNDLIDMLDGEEFDERPVDLRTFVTSPEYLGL |
Ga0315909_106308641 | 3300031857 | Freshwater | MDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLG |
Ga0315901_102340611 | 3300031963 | Freshwater | MSFDFEDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQY |
Ga0315902_108552351 | 3300032093 | Freshwater | MQVDLNFNDIIDILDGEEFDEKPVDLKTFVTSPDYLGLPPLSE |
Ga0315903_102949631 | 3300032116 | Freshwater | VDLNFNDLIDILDGEEFDERPVDLRTFVTGQDYLA |
Ga0315903_106545583 | 3300032116 | Freshwater | MQRKQVDLDFNDLIDILDGEEFDEKPVDLRTFVTSPDYLGLPP |
Ga0315903_109784491 | 3300032116 | Freshwater | MQRKLVDLNFNDLIDILDGEEFDERPVDLRTFVTSPDYL |
Ga0334992_0432945_1_159 | 3300033992 | Freshwater | MSFNFSDLIDILDGEEFDEKPVDLKTFVNSPEYLGLPPLSEFQYTLIEKSSQI |
Ga0334992_0447548_3_110 | 3300033992 | Freshwater | MSVDFNFDDLIDMLDGEEFDERPVDLRTFVTDPQFL |
Ga0335028_0145106_2_112 | 3300034071 | Freshwater | MDLNFNDLIDILDGEEFEERPVDLQTFVTSPNYLALP |
Ga0335066_0077241_3_134 | 3300034112 | Freshwater | MDLNFNDLIDILDGEEFDERPVDLRTFVTSPEYLGLPPLSEHQY |
Ga0335053_0500749_605_715 | 3300034118 | Freshwater | MDLNFNDLIDILDGEEFDERPVDLITFVTSPDYLGLP |
Ga0335056_0239284_870_1028 | 3300034120 | Freshwater | MSFNFSDIIDILDNEEFEERPVDLQTFVTNPNYLALPPLSNYQYTLIEKSSQI |
Ga0335058_0533233_2_127 | 3300034121 | Freshwater | MSFDFSDIIDMLDGEEFDEKPVSLRDFVTNEKYLGLPELSEY |
Ga0335061_0658496_405_521 | 3300034168 | Freshwater | MSFDFSDIIDMLDGEEFDEKPVSLRDFVTDEKYLGLPEL |
Ga0335065_0028744_3779_3919 | 3300034200 | Freshwater | MSFDFADLIDMLDGEEFDEKPVDLKTFVRSPEYLGLPELSDYQYTLI |
Ga0335065_0325051_856_963 | 3300034200 | Freshwater | MSFNFSDIIDILDNEEFEERPVDLQTFVTSPNYLAL |
Ga0335049_0000982_1_111 | 3300034272 | Freshwater | MSFEFTDLIDMLDGEEFDEKPVDLKTFVRSPEYLGLP |
Ga0334997_0716814_480_608 | 3300034280 | Freshwater | MDLNFNDLIDMLDGEEFDERPVDLRTFVQSPDYLGLPPLSEYQ |
Ga0310143_19335_3_125 | 3300034523 | Fracking Water | MDLNFNDLIDILDGEEFEERPVDLRTFVTSPEYLGLPPLSE |
⦗Top⦘ |