NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F059819

Metagenome Family F059819

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059819
Family Type Metagenome
Number of Sequences 133
Average Sequence Length 50 residues
Representative Sequence VPRLLVIDDRDQTVEMVHRQLPEFDTVTRCDRRIPCQVCEERERGCPLRCA
Number of Associated Samples 123
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.24 %
% of genes near scaffold ends (potentially truncated) 98.50 %
% of genes from short scaffolds (< 2000 bps) 97.74 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.278 % of family members)
Environment Ontology (ENVO) Unclassified
(33.835 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.586 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.78%    β-sheet: 0.00%    Coil/Unstructured: 77.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF11141DUF2914 7.52
PF01145Band_7 5.26
PF01713Smr 5.26
PF01554MatE 2.26
PF14522Cytochrome_C7 0.75
PF01790LGT 0.75
PF11794HpaB_N 0.75
PF13432TPR_16 0.75
PF01757Acyl_transf_3 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.25 %
UnclassifiedrootN/A0.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459015|G14TP7Y01C2D5UAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium618Open in IMG/M
3300000956|JGI10216J12902_110679268All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300001213|JGIcombinedJ13530_100029485All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300001593|JGI12635J15846_10560033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium668Open in IMG/M
3300005093|Ga0062594_101324025All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium725Open in IMG/M
3300005171|Ga0066677_10589747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300005176|Ga0066679_10798148All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300005181|Ga0066678_10264874All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1115Open in IMG/M
3300005329|Ga0070683_101028648All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium791Open in IMG/M
3300005329|Ga0070683_101566781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium633Open in IMG/M
3300005344|Ga0070661_100805580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales771Open in IMG/M
3300005345|Ga0070692_11012082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium582Open in IMG/M
3300005354|Ga0070675_100354429All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1302Open in IMG/M
3300005354|Ga0070675_101788892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300005355|Ga0070671_101018570All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium726Open in IMG/M
3300005438|Ga0070701_10179901All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1237Open in IMG/M
3300005454|Ga0066687_10284729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium932Open in IMG/M
3300005456|Ga0070678_101973214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300005459|Ga0068867_102386388All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300005466|Ga0070685_10834696All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium682Open in IMG/M
3300005537|Ga0070730_10988001All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300005548|Ga0070665_100227121All Organisms → cellular organisms → Bacteria → Proteobacteria1867Open in IMG/M
3300005560|Ga0066670_10946095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300005566|Ga0066693_10297604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium644Open in IMG/M
3300005568|Ga0066703_10308737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium956Open in IMG/M
3300005569|Ga0066705_10253914All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1114Open in IMG/M
3300005569|Ga0066705_10821940All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300005598|Ga0066706_11295457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300005614|Ga0068856_100503867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1232Open in IMG/M
3300005615|Ga0070702_100274665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1154Open in IMG/M
3300005618|Ga0068864_100829687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium910Open in IMG/M
3300005831|Ga0074471_10808260All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium791Open in IMG/M
3300005993|Ga0080027_10065423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1331Open in IMG/M
3300006031|Ga0066651_10841110All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300006794|Ga0066658_10701166All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300006854|Ga0075425_101712396All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium707Open in IMG/M
3300006903|Ga0075426_11210490All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300009037|Ga0105093_10253501Not Available923Open in IMG/M
3300009137|Ga0066709_102595718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium679Open in IMG/M
3300010293|Ga0116204_1214041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300010398|Ga0126383_10112264All Organisms → cellular organisms → Bacteria → Proteobacteria2462Open in IMG/M
3300010403|Ga0134123_12803636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300012203|Ga0137399_10263731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1416Open in IMG/M
3300012205|Ga0137362_10647734All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium909Open in IMG/M
3300012362|Ga0137361_10562488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1046Open in IMG/M
3300012918|Ga0137396_10287274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1215Open in IMG/M
3300012923|Ga0137359_10620937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium947Open in IMG/M
3300012923|Ga0137359_11098625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium680Open in IMG/M
3300012925|Ga0137419_11577933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300012930|Ga0137407_10443389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1207Open in IMG/M
3300013102|Ga0157371_10864945All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300013105|Ga0157369_11340370All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300013306|Ga0163162_12497424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300014256|Ga0075318_1023723All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium927Open in IMG/M
3300014325|Ga0163163_12954584All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300014968|Ga0157379_10536100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1088Open in IMG/M
3300015241|Ga0137418_10322516All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1284Open in IMG/M
3300015245|Ga0137409_10597656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium nitroreducens933Open in IMG/M
3300015356|Ga0134073_10145028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium746Open in IMG/M
3300016357|Ga0182032_10318664All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1234Open in IMG/M
3300016445|Ga0182038_12038777All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300017789|Ga0136617_11139033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300017965|Ga0190266_10685937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300018081|Ga0184625_10484619All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
3300018083|Ga0184628_10550232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium590Open in IMG/M
3300018433|Ga0066667_10803064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium800Open in IMG/M
3300018482|Ga0066669_11879083All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300020000|Ga0193692_1016068All Organisms → cellular organisms → Bacteria → Proteobacteria1806Open in IMG/M
3300020000|Ga0193692_1066590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium800Open in IMG/M
3300020000|Ga0193692_1097200All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium626Open in IMG/M
3300020582|Ga0210395_10182983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1570Open in IMG/M
3300021181|Ga0210388_10005667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae9777Open in IMG/M
3300021402|Ga0210385_11566507All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300023311|Ga0256681_10731949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300024275|Ga0247674_1041003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300024283|Ga0247670_1095825All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300025878|Ga0209584_10350731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300025893|Ga0207682_10551640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300025918|Ga0207662_10883221All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300025924|Ga0207694_10611913All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium916Open in IMG/M
3300025926|Ga0207659_10160051All Organisms → cellular organisms → Bacteria → Proteobacteria1766Open in IMG/M
3300025936|Ga0207670_11847546All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300025940|Ga0207691_10301606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1376Open in IMG/M
3300025961|Ga0207712_12099976All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300025986|Ga0207658_12016066All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300026121|Ga0207683_11816101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300026142|Ga0207698_11742991All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300026312|Ga0209153_1047753All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1511Open in IMG/M
3300026547|Ga0209156_10376908All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium601Open in IMG/M
3300026551|Ga0209648_10542643All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300026557|Ga0179587_10078854All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1953Open in IMG/M
3300026557|Ga0179587_10584157All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium735Open in IMG/M
3300028745|Ga0302267_10440985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300028762|Ga0302202_10472035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300028800|Ga0265338_10798134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300028802|Ga0307503_10139855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1086Open in IMG/M
3300028869|Ga0302263_10362621All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300029922|Ga0311363_10471459All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300030003|Ga0302172_10118679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium812Open in IMG/M
3300031232|Ga0302323_100204044All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1999Open in IMG/M
3300031247|Ga0265340_10076916All Organisms → cellular organisms → Bacteria → Proteobacteria1575Open in IMG/M
3300031521|Ga0311364_10469171All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1275Open in IMG/M
3300031524|Ga0302320_11126897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium814Open in IMG/M
3300031640|Ga0318555_10451626All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M
3300031712|Ga0265342_10072957All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1997Open in IMG/M
3300031723|Ga0318493_10696614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300031751|Ga0318494_10414593All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium782Open in IMG/M
3300031765|Ga0318554_10115118All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1516Open in IMG/M
3300031765|Ga0318554_10810657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300031788|Ga0302319_11704617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300031799|Ga0318565_10558079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300031820|Ga0307473_11358266All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300031846|Ga0318512_10411702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium680Open in IMG/M
3300031902|Ga0302322_101270715All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium894Open in IMG/M
3300031939|Ga0308174_11093397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium678Open in IMG/M
3300031939|Ga0308174_11671476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300031954|Ga0306926_11026852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium980Open in IMG/M
3300031995|Ga0307409_102125167All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium591Open in IMG/M
3300032000|Ga0310903_10393915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium704Open in IMG/M
3300032065|Ga0318513_10406831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium664Open in IMG/M
3300032066|Ga0318514_10356554All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium775Open in IMG/M
3300032068|Ga0318553_10434905All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium687Open in IMG/M
3300032074|Ga0308173_11322803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium675Open in IMG/M
3300032173|Ga0315268_10156473All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2167Open in IMG/M
3300032205|Ga0307472_100484037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1062Open in IMG/M
3300032205|Ga0307472_102760506All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300032783|Ga0335079_11866855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300033004|Ga0335084_10915791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium886Open in IMG/M
3300033482|Ga0316627_102606842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300033521|Ga0316616_102156055All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium741Open in IMG/M
3300034128|Ga0370490_0256721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300034156|Ga0370502_0230756All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium591Open in IMG/M
3300034195|Ga0370501_0316619All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.53%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.02%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.01%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.01%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.26%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.26%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil2.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.26%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.26%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.26%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.50%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.50%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.75%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water0.75%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.75%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.75%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.75%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.75%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.75%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.75%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.75%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459015Litter degradation PV4EngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010293Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaGEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014256Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300024275Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030003Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034156Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4PV_026891002170459015Switchgrass, Maize And Mischanthus LitterMPRLLVIDDRDATVEMCHRQLSQFDYVTRCDRRVPCPGVPRSRDKGCPLKCAHDYGEAAETLRR
JGI10216J12902_11067926813300000956SoilMPRLLVIDDRDQTVQMCQRHLPQFDYVTRCNRSIPCQVCEERDRG
JGIcombinedJ13530_10002948523300001213WetlandMPRLLIIDDRDQTVEMCHRHLPELETVTRCDRSIPCQVCEERERGC
JGI12635J15846_1056003313300001593Forest SoilMTLPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRPHPCQVCEERDKGCPLKC
Ga0062594_10132402533300005093SoilVPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRNIPCQVCEERERGCPLRCAHD
Ga0066677_1058974723300005171SoilMPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRAHPCQVCEERDKGC
Ga0066679_1079814823300005176SoilVARLLVIDDRDQTVEMVHRHLPQFETVTRCGRSIPCQVCEERD
Ga0066678_1026487433300005181SoilVARLLVIDDRDQTVEMVHRHLPQFETVTRCGRSIPCQVCEERDRGCTLKCAHDYSEAAE
Ga0070683_10102864833300005329Corn RhizosphereVPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRRIPCQVCEE
Ga0070683_10156678113300005329Corn RhizosphereVPRLFVIDDRDQTVEMVHRRLPQMETLTRCERNVPCQVCEERERGCPLRCAHDWGEAE
Ga0070661_10080558033300005344Corn RhizosphereVPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRRIPCQVCEERER
Ga0070692_1101208213300005345Corn, Switchgrass And Miscanthus RhizosphereVPRLLVIDDRDQTVEMVQRQLPQFDTITRCDRRIPCSVCEERDRACPLKCAHDWQEAADSRPS
Ga0070675_10035442913300005354Miscanthus RhizosphereVPRLLVIDDRDQTVEMVHRQLPEFDTVTRCDRRIPCQVCEERERGCPLRCAHDY
Ga0070675_10178889213300005354Miscanthus RhizosphereMPKLLVIDDRDQTVEMVHRQLPEFETVTRCDRRIPCQVCEERDRGCPL
Ga0070671_10101857033300005355Switchgrass RhizosphereVPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRRIPCQVCEERERGCPLRCAHDYGE
Ga0070701_1017990143300005438Corn, Switchgrass And Miscanthus RhizosphereMPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRNIPCQVCEERERGCPLR
Ga0066687_1028472933300005454SoilVPRLLVIDDRDQTVEMVHRHLPQFETVTRCGRSIPCQVCEERERGCTLKCAHD
Ga0070678_10197321413300005456Miscanthus RhizosphereVPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRNIPCQVCEE
Ga0068867_10238638813300005459Miscanthus RhizosphereVPRLLVIDDRDQTVEMVHRQLPEFDTVTRCDRRIPCQVCEERERGCPLRCA
Ga0070685_1083469613300005466Switchgrass RhizosphereMPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRNIPCQVCEERERGCPLRCAHDYGEAAQALS
Ga0070730_1098800123300005537Surface SoilVPRLLVIDDKDQTIEMCHRHLPQFDYLTRCGRGHPCQVCEERDKGCPLKCAHDYLEAD
Ga0070665_10022712113300005548Switchgrass RhizosphereMPKLLVIDDRDQTVEMVHRQLPEFETVTRCDRRIPCQVCEER
Ga0066670_1094609513300005560SoilVPRLLIIDDRDQTVEMVHRHLPQFETITRCGRNIPCQVCEERDRGCTLKC
Ga0066693_1029760423300005566SoilMPRLLVIDDRDQTVEMCHRQLPQFDYLTRCDRKVPCQVCE
Ga0066703_1030873713300005568SoilVARLLVIDDRDQTVEMVHRYLPQFETVTRCGRSIPCQVCEERDRGCT
Ga0066705_1025391413300005569SoilVPRLLVIDDRDQTVEMVHRHLPQFETVTRCGRSIPCQVCEERERGCTL
Ga0066705_1082194013300005569SoilMPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRRHPCQVCEERDKGCTLKC
Ga0066706_1129545713300005598SoilVARLLVIDDRDQTGEMVHRHLPQFETVTRCGRSIPCQ
Ga0068856_10050386743300005614Corn RhizosphereMPRLLVIDDRDQTVEMVHRQLPHLETVTRCDRRIPCQVCEERTRGCPLRCAHD
Ga0070702_10027466533300005615Corn, Switchgrass And Miscanthus RhizosphereVPRLLVIDDRDQTVEMVHRQLPQFDTITRCERRIPCLVCEERDRGCPLKCAHDWQEA
Ga0068864_10082968713300005618Switchgrass RhizosphereMTRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRSIPCQVCEERERGCPLRCAHDYGEAAQA
Ga0074471_1080826013300005831Sediment (Intertidal)MPRILVIDDRDQTIELCHRHLHGFDYLTRCDRAIPCQV
Ga0080027_1006542343300005993Prmafrost SoilMPRVLVIDDRDQTVEMVHRRLPQLETVTRCDRSVPCQVCEERARGCPLRCAHD
Ga0066651_1084111023300006031SoilMARLLVIDDRDQTVEMCHRHLPQFDYLTRCDRRIPCQVCEERDRACPLKCAHDYGE
Ga0066658_1070116613300006794SoilMPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRRHPCQVCEERDNGCKLK
Ga0075425_10171239623300006854Populus RhizosphereMPRLLVIDDRDQTVEMVHRRLPQLETVTRCGRRVPCQVCEERERGCTMRCAHDWGEAAE
Ga0075426_1121049013300006903Populus RhizosphereVARLLVIDDRDQTVEMVHRHLPQFETVTRCGRSIPCQVCEERDR
Ga0105093_1025350123300009037Freshwater SedimentMPRLLVIDDRDQTVEMCHRQLPDFDTVSRCARSIPCQVCEE
Ga0066709_10259571813300009137Grasslands SoilMPRLLVIDDRDQTVEMVHRQLPEFDTVTRCDRRIPCQVCEERERGCALRCAHDYGEAAQALASL
Ga0116204_121404123300010293Anoxic Lake WaterMPRLLVIDDRDQTIEMCHRNLGEFDYVTRCDRQIPC
Ga0126383_1011226443300010398Tropical Forest SoilMPRLLVIDDRDQTVEMVHRQMPQFETVTRCDRAIPCQVCEERTGGCPLRCAHDYAVAAEALGRQP
Ga0134123_1280363613300010403Terrestrial SoilMKRTQRSLAVPRLLVIDDRDQTVEMIHRRLPQLETVTRCDRRVPCQVCDERERGC
Ga0137399_1026373113300012203Vadose Zone SoilMPRLLVIDDRDQTIEMCHRQLPQFDYVTRCGRKHPCQVCEERDKGCPYKCAHDAAE
Ga0137362_1064773433300012205Vadose Zone SoilMPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRRHPCQVC
Ga0137361_1056248813300012362Vadose Zone SoilMPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRRHPCQV
Ga0137396_1028727413300012918Vadose Zone SoilMPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRRHPCQVCEERDKGCTLKCAHNADEAAEALGQE
Ga0137359_1062093713300012923Vadose Zone SoilMPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRKHPCQVCEERDKGCPYKCAHNAEEAAHALG
Ga0137359_1109862533300012923Vadose Zone SoilMPRLLVIDDRDQTIEMCHRNLPQFDYVTRCGRPHPCQVCEERDKGC
Ga0137419_1157793323300012925Vadose Zone SoilMPRLLVIDGRDQTIEMCHRQLPQFDYVTRCGRKHPCQVCE
Ga0137407_1044338913300012930Vadose Zone SoilVARLLVIDDRDQTVEMVHRHLPQFETVTRCGRSIPCQV
Ga0157371_1086494513300013102Corn RhizosphereMPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRNIPCQVCEERERGCPL
Ga0157369_1134037033300013105Corn RhizosphereMPRLLVIDDRDQTVEMVHRQMPQFETVTRCDRNIPCQVCEERTRGCPLRCA
Ga0163162_1249742423300013306Switchgrass RhizosphereMPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRNIPCQVCEERERGCPLRCA
Ga0075318_102372313300014256Natural And Restored WetlandsMPRLLVIDDRDQTVEMCHRHLPEFDTVTRCDRNLPCQVCEERERGCQLKCAHDFREAALALARL
Ga0163163_1295458413300014325Switchgrass RhizosphereMTRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRRIPCQVCEERERGCPLRCAHDY
Ga0157379_1053610013300014968Switchgrass RhizosphereMPRLLVIDDRDQTVEMVHRQMPQFETVTRCDRRIPCQVCEERERGCPLRCAHDYGE
Ga0137418_1032251643300015241Vadose Zone SoilMPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRRHPCQVCEERDKGCTLKCAH
Ga0137409_1059765623300015245Vadose Zone SoilMPRLLVIDDRDQTVEMVHRRLPQLETVTRCDRRVPCQVC
Ga0134073_1014502833300015356Grasslands SoilMPKLFVIDDRDQTVEMVHRHLPQFETVTRCDRNIPCQVCEERDRGCPLKC
Ga0182032_1031866443300016357SoilVPRLLVIDDRDQTVEMVHRQMPDLDTVTRCDRRIPCQVCEERTR
Ga0182038_1203877723300016445SoilVPRLLVIDDRDQTVEMVHRQLPQFDTVTRCDRRIPCQVCEERTRGCPLRCAHDWAEAA
Ga0136617_1113903313300017789Polar Desert SandVSVAGNVPRLLVIDDRDQTIEMCHRQLPQFDYVTRCERRIPCQVCEERDRA
Ga0190266_1068593713300017965SoilMPRILVIDDRDQTVEMCHRQLPQFDYVTRCDRRIPCQVCEERDRGCPLKCAHDYF
Ga0184625_1048461923300018081Groundwater SedimentMPRLLVIDDRDQTVEMCHRQLPQFDYLTRCERQIPCQVCE
Ga0184628_1055023213300018083Groundwater SedimentVPKLLVIDDRDQTVEMVHRQLPEFETVTRCDRRIP
Ga0066667_1080306433300018433Grasslands SoilMPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRRIPCQVCEERERGCPLRCAHDYGE
Ga0066669_1187908313300018482Grasslands SoilVPKLFVIDDRDQTVEMVHRHLPQFETVTRCDRNIPCQVCEERDRGCPLK
Ga0193692_101606843300020000SoilMPRILVIDDRDQTVEMCHRQLPQFDYVTRCERRIPCQVCEERDRGCPLKCAHDYAEAAEVLGR
Ga0193692_106659043300020000SoilMPRILVIDDRDQTVEMCHRHLPQFDYVTRCDRRIPCQVCEERDRGCPLKCAHDYQEAADVLAR
Ga0193692_109720013300020000SoilMPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRRIPCQVCEER
Ga0210395_1018298313300020582SoilMPRLLVIDDRDQTVEMVHRQMPQFETVTRCDRRIPCQVCEERTRGCPL
Ga0210388_1000566793300021181SoilMPRLLVIDDRDQTVEMVHRQMPQFETVTRCDRRVP
Ga0210385_1156650723300021402SoilMPRLLVIDDRDQTVEMVHRQLPQFDTVTRCERRIPCQVCEERTRG
Ga0256681_1073194913300023311FreshwaterMPRLLVIDDRDQTVEMCHRQLPEFDTITRCDRAVPCQVCE
Ga0247674_104100323300024275SoilVPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRNIPCQVCEERERGCPLRCAHDYGEAAEALG
Ga0247670_109582513300024283SoilMPRILVIDDRDQTVEMCHRQLPQFDYVTRCERRIPCQ
Ga0209584_1035073133300025878Arctic Peat SoilVPRILVIDDRDQTVEMCHRHLPALDTVTRCDRAAPCQVCEERERGCPLKCAHDFREADEVLA
Ga0207682_1055164013300025893Miscanthus RhizosphereMPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRNIPCQVCEERERGC
Ga0207662_1088322113300025918Switchgrass RhizosphereMPRLLVIDDRDQTIELCHRHLPQFDYVTRCGRKHPCQVCEERDNGCKLKCAHDY
Ga0207694_1061191313300025924Corn RhizosphereMPRLLVIDDRDQTVEMVHRQMPQFETVTRCDRRIPC
Ga0207659_1016005113300025926Miscanthus RhizosphereVPRLLVIDDRDQTVEMVHRQLPEFDTVTRCDRRIPCQV
Ga0207670_1184754623300025936Switchgrass RhizosphereMPKLLVIDDRDQTVEMVHRQLPEFETVTRCDRRIPCQVCEERDR
Ga0207691_1030160613300025940Miscanthus RhizosphereVPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRNIPCQVCEERERGCPLRCAHDYGEAA
Ga0207712_1209997613300025961Switchgrass RhizosphereMPRLLVIDDRDQTVEMCHRHLPQFDYVTRCDRRIPCQVCEERDRRCPKKCAHDYGEAVEVLRG
Ga0207658_1201606623300025986Switchgrass RhizosphereVPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRRIPCQVCEERERGCPLRCAHD
Ga0207683_1181610113300026121Miscanthus RhizosphereVPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRRIPCQVCEERERGCPLRCAHDYGEAAQALAR
Ga0207698_1174299123300026142Corn RhizosphereMPRLLVIDDRDQTVEMVHRQLPHLETVTRCDRRIPCQVCE
Ga0209153_104775313300026312SoilVPRLLIIDDRDQTVEMVHRHLPQFETITRCGRNIPCQVCEERDRGCTLKCA
Ga0209156_1037690813300026547SoilVPRLLIIDDRDQTVEMVHRHLPQFETVTRCGRSIPCQVCEERDRGCTLKCAHDYAEAAEALS
Ga0209648_1054264323300026551Grasslands SoilMPRLLVIDDRDQTIEMCHRQLPQFDYLTRCGRPHPCQVCEERDKGCPLKCAHD
Ga0179587_1007885413300026557Vadose Zone SoilMPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRRHPCQVCEERDKGCTLKCAHNADEAAEALG
Ga0179587_1058415733300026557Vadose Zone SoilMPRLLVIDDRDQTIEMCHRQLPQFDYVTRCGRKHPCQVCEERDKGCPYKCAHDAA
Ga0302267_1044098513300028745BogMPRLLVIDDRDQTIEMVQRRLPQFETVTRCEKSIPCQVCEERERGCPLRCA
Ga0302202_1047203513300028762BogMPRLFVIDDRDQTIDMLQRRLPQFETVTRCGKNIPCQVCEERERGCTLRCAHD
Ga0265338_1079813433300028800RhizosphereVPKILVIDDRDQTVEMCHRHLPALDTVTRCDRAAPCQVCEERERGCPLKCAHD
Ga0307503_1013985543300028802SoilVPRLLVIDDRDQTVEMVHRQLPEFDTVTRCDRRIPCQVCEE
Ga0302263_1036262123300028869FenMPRLLVIDDRDQTIEMCHRHLPELDTVTRCDRGIPCQVCEERERGCPLKCAHDY
Ga0311363_1047145933300029922FenMPRLFVIDDRDQTIDMLQRRLPQFETVTRCGKNIPCQVCEERERGCTLRCAHDWQEAESALAAQG
Ga0302172_1011867913300030003FenMPRLLVIDDRDQTVEMCHRQLPEFDTVTRCDRTVPCQVCEERDRGCPLKCAHEY
Ga0302323_10020404443300031232FenMPRLLVIDDRDQTIEMCHRHLPEFDTVARCDRGIPCQVCEERERSCPL
Ga0265340_1007691633300031247RhizosphereMPRLLVIDDRDQTVEMVHRQMPQFETVTRCDRRIPCQVCEERTRGCPLRCAHDYAEAAEALGRQP
Ga0311364_1046917143300031521FenMPRLLVIDDRDQTVEMCHRQLPEFDTVTRCDRTVP
Ga0302320_1112689733300031524BogMPRLLVIDDRDQTIEMVQRRLPQFETVTRCEKSIP
Ga0318555_1045162613300031640SoilMPRLLVIDDRDQTVEMLHRRLPQLETVTRCDRRVPCQVCEERERGCPLRCAHDWG
Ga0265342_1007295743300031712RhizosphereMPRLLFIDDRDQTVEMCHRQLPAFDTITRCDRHIPCQVCEERDRG
Ga0318493_1069661413300031723SoilMPRLLVIDDRDQTVEMVHRRLPQLETVTRCDRRVPCQVCEERERGCPLRCAHDWGEAAEALGRA
Ga0318494_1041459333300031751SoilMPRLLVIDDRDQTVEMVHRRLPQLETVTRCERSAPCQVCEERERGGPLRCAHDW
Ga0318554_1011511843300031765SoilVPRLLVIDDRDQTVEMVHRQLPQFDTVTRCDRRIPCQVCEERTRGCPLRCAHD
Ga0318554_1081065723300031765SoilMPRLLVIDDRDQTVDMVQRRLPQLETVTRCDRRVPCQVCEERERGCPLRC
Ga0302319_1170461713300031788BogMPRLLVIDDRDQTIEMVQRRLPQFETVTRCEKSIPCQVCEERERGCPLRCAH
Ga0318565_1055807923300031799SoilVPRLLIIDDRDQTVEMVHRQMPDLDTVTRCDRRIPCQVCEERT
Ga0307473_1135826613300031820Hardwood Forest SoilMPRLLVIDDRDQTIEMCHRHLPQFDYVTRCDRPHPCQVCEERDKGCPLKCAHDYFEAAQALSREG
Ga0318512_1041170213300031846SoilMPRLLVIDDRDQTVEMVHRRLPQLETVTRCDRRVPCQVCE
Ga0302322_10127071513300031902FenMPRILVIDDRDQTIELCHRNLHAFDYLTRCDRAIPCQVCEERDKGCPLKCAHDFAEATQALRQTS
Ga0308174_1109339723300031939SoilMPRLLVIDDRDQTVDMVQRQLPEFDTVTRCDRRIPCQVCEERERGCPLRCAHDY
Ga0308174_1167147613300031939SoilMPRLLVIDDRDQTVEMVHRQMPQFETVTRCDRRIPCQVCE
Ga0306926_1102685213300031954SoilMPRLLVIDDRDQTVEMVHRQLPQLETVTRCDRRIPCQVCDERTRGCPLRCA
Ga0307409_10212516723300031995RhizosphereMPRLLVIDDRDQTVEMVHRQLPEFETITRCDRPIPCQVCEERERGCPLRCAHDYGEAAQ
Ga0310903_1039391513300032000SoilVPRLLVIDDRDQTVDMVHRQLPEFDTVTRCDRRIPCQVCEER
Ga0318513_1040683123300032065SoilVPRLLVIDDRDQTVEMVHRQLPQFDTVTRCDRRIPCQVCEERTRGCPLRCAHDYAEASQA
Ga0318514_1035655433300032066SoilVPRLLVIDDRDQTVEMVQRQLPQYETVTRCDRRIPCQV
Ga0318553_1043490513300032068SoilVPRLLVIDDRDQTVEMVHRQLPQFDTVTRCDRRIPCQVCEERTRGCPLR
Ga0308173_1132280313300032074SoilVPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGKPHPCQVCEERDKGCPFKCAHDYFEAAEALGRER
Ga0315268_1015647313300032173SedimentMPRLFIIDDRDRTVEMCHRHLGQFDYVTRCDRSVPCQVCD
Ga0307472_10048403743300032205Hardwood Forest SoilVARLLVIDDRDQTVEMVHRHLPQFETVTRCGRSIPCQVCEER
Ga0307472_10276050613300032205Hardwood Forest SoilVPRLLVIDDRDQTIEMCHRHLPQFDYVTRCGRPHPCQVCEERDNGCPLK
Ga0335079_1186685523300032783SoilMARLLVIDDRDQTVEMCHRQLPQFDYLTRCQRRIPCQVCEERDRQCALKCAHDYEEAAEMLARAEA
Ga0335084_1091579113300033004SoilLPRLLVIDDRDQTVEMVQRQLPQFDTVTRCDRSIPCQVCEEREKGCPLRCAHDFAEAAEALGRAG
Ga0316627_10260684223300033482SoilMPRLFIIDDRDRTVEMCHRHLGQFDYVTRCDRNIPCQVCDQRDRGCPLKCAHDYREAQETLAR
Ga0316616_10215605523300033521SoilMPRLFIIDDRDRTVEMCHRHLGQFDYVTRCDRNVPCQVCDQRDRGCPLKCAHDYQEALET
Ga0370490_0256721_400_5763300034128Untreated Peat SoilMPRLLVIDDRDQTVEMCHRQLPDFDTVSRCERSIPCQVCEERDRGCPLKCAHDHREAAE
Ga0370502_0230756_487_5913300034156Untreated Peat SoilMPRLLVIDDRDQTVEMCHRYLPEFDTVTRCDRGIP
Ga0370501_0316619_2_1903300034195Untreated Peat SoilVPKILVVDDRDETVAMCHRQLPQFDYLTRCDRPIPCQVCEERERGCPLKCAHDYGEAAEVLRK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.