Basic Information | |
---|---|
Family ID | F061114 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 132 |
Average Sequence Length | 39 residues |
Representative Sequence | MSARLRWRKFVSGFMLTMTGVCAVVAVSVLFFILGYL |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 88.64 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.42 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.970 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.303 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.545 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.23% β-sheet: 0.00% Coil/Unstructured: 50.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF00528 | BPD_transp_1 | 90.91 |
PF12849 | PBP_like_2 | 8.33 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001213|JGIcombinedJ13530_105014521 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300001471|JGI12712J15308_10012268 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
3300001593|JGI12635J15846_10399234 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300001661|JGI12053J15887_10308384 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100310019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1462 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100694755 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300005179|Ga0066684_10966578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 552 | Open in IMG/M |
3300005458|Ga0070681_11627960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 571 | Open in IMG/M |
3300005553|Ga0066695_10450005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 794 | Open in IMG/M |
3300005568|Ga0066703_10613481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 633 | Open in IMG/M |
3300005598|Ga0066706_10258196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1358 | Open in IMG/M |
3300005994|Ga0066789_10284809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 692 | Open in IMG/M |
3300006041|Ga0075023_100444600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 571 | Open in IMG/M |
3300006175|Ga0070712_101289211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 636 | Open in IMG/M |
3300006176|Ga0070765_100021256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4862 | Open in IMG/M |
3300006854|Ga0075425_100175305 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
3300007255|Ga0099791_10664891 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300009143|Ga0099792_10432295 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300010043|Ga0126380_10816640 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300010043|Ga0126380_10856891 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300010048|Ga0126373_12907508 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010343|Ga0074044_10640503 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300010359|Ga0126376_11370871 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300010360|Ga0126372_11165438 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300010376|Ga0126381_102330359 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300010398|Ga0126383_11235192 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300011269|Ga0137392_11448412 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300011271|Ga0137393_11183781 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300012096|Ga0137389_11844498 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300012203|Ga0137399_10080258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2475 | Open in IMG/M |
3300012203|Ga0137399_11465751 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012205|Ga0137362_11038227 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300012354|Ga0137366_10193571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1521 | Open in IMG/M |
3300012363|Ga0137390_10421543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1312 | Open in IMG/M |
3300012363|Ga0137390_11204420 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300012917|Ga0137395_10423826 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300012918|Ga0137396_10966590 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012922|Ga0137394_10600442 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300012924|Ga0137413_10173076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1430 | Open in IMG/M |
3300012960|Ga0164301_10979550 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300012971|Ga0126369_10683213 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300014153|Ga0181527_1222899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 774 | Open in IMG/M |
3300015054|Ga0137420_1095461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1636 | Open in IMG/M |
3300015054|Ga0137420_1222612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3115 | Open in IMG/M |
3300015242|Ga0137412_10817676 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300015356|Ga0134073_10193637 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300016445|Ga0182038_11290529 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300016750|Ga0181505_10370913 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300018006|Ga0187804_10098103 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300018058|Ga0187766_11013543 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300018062|Ga0187784_11631216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 511 | Open in IMG/M |
3300018086|Ga0187769_11421677 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300019788|Ga0182028_1007280 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300020062|Ga0193724_1053429 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300020150|Ga0187768_1016681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1544 | Open in IMG/M |
3300020170|Ga0179594_10357701 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300020580|Ga0210403_10480321 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300020581|Ga0210399_10478431 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300020583|Ga0210401_11003942 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300021088|Ga0210404_10554505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 651 | Open in IMG/M |
3300021168|Ga0210406_10725343 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300021168|Ga0210406_11249944 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300021171|Ga0210405_10070932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2747 | Open in IMG/M |
3300021171|Ga0210405_10608739 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300021180|Ga0210396_11495137 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300021307|Ga0179585_1128679 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300021401|Ga0210393_10183511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1688 | Open in IMG/M |
3300021405|Ga0210387_11155895 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300021432|Ga0210384_11540809 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300021474|Ga0210390_10808207 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300021560|Ga0126371_11191127 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300024186|Ga0247688_1005017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1876 | Open in IMG/M |
3300024219|Ga0247665_1048145 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300025474|Ga0208479_1079340 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300025527|Ga0208714_1044206 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300025939|Ga0207665_11555282 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300026308|Ga0209265_1140204 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300026328|Ga0209802_1182015 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300026330|Ga0209473_1080295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1377 | Open in IMG/M |
3300026529|Ga0209806_1147210 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300026530|Ga0209807_1280304 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300026551|Ga0209648_10058091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3289 | Open in IMG/M |
3300026552|Ga0209577_10840525 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300026692|Ga0207725_107760 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300026879|Ga0207763_1011049 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300026959|Ga0207852_1001636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2696 | Open in IMG/M |
3300027024|Ga0207819_1049170 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300027473|Ga0207508_102713 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300027562|Ga0209735_1031775 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300027565|Ga0209219_1094667 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300027667|Ga0209009_1018421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1686 | Open in IMG/M |
3300027737|Ga0209038_10076603 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300027855|Ga0209693_10124923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1272 | Open in IMG/M |
3300027869|Ga0209579_10653158 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300028047|Ga0209526_10558469 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300028138|Ga0247684_1080124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
3300028138|Ga0247684_1080275 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300028381|Ga0268264_12266554 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300028800|Ga0265338_10485658 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300029636|Ga0222749_10235682 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300030490|Ga0302184_10386403 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300031446|Ga0170820_12281221 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300031546|Ga0318538_10762655 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300031715|Ga0307476_10423654 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300031720|Ga0307469_11110761 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300031720|Ga0307469_11728941 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300031724|Ga0318500_10620704 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300031726|Ga0302321_101448541 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300031753|Ga0307477_10090723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2122 | Open in IMG/M |
3300031754|Ga0307475_10131195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1980 | Open in IMG/M |
3300031754|Ga0307475_10899984 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300031765|Ga0318554_10238428 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300031781|Ga0318547_10920029 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300031820|Ga0307473_10844081 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300031823|Ga0307478_11148548 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300031823|Ga0307478_11598388 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300031890|Ga0306925_12274533 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300031897|Ga0318520_10608065 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300031910|Ga0306923_10644036 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300031910|Ga0306923_11690131 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300031946|Ga0310910_10525501 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300031981|Ga0318531_10357197 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300032001|Ga0306922_11347877 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300032035|Ga0310911_10106781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1541 | Open in IMG/M |
3300032035|Ga0310911_10141809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1347 | Open in IMG/M |
3300032035|Ga0310911_10158919 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300032205|Ga0307472_100951031 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300032205|Ga0307472_101052278 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300032805|Ga0335078_12520106 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300033289|Ga0310914_10311032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1421 | Open in IMG/M |
3300033402|Ga0326728_10149671 | All Organisms → cellular organisms → Bacteria | 2538 | Open in IMG/M |
3300033983|Ga0371488_0521290 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.97% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.15% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.79% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.03% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.52% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.52% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.52% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.76% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.76% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.76% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.76% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.76% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.76% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.76% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026692 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 38 (SPAdes) | Environmental | Open in IMG/M |
3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
3300027473 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK08-D (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13530_1050145211 | 3300001213 | Wetland | MNRRHYWRKTVNAFMFLMAGLCALITVSVLFFILGFLV |
JGI12712J15308_100122683 | 3300001471 | Forest Soil | MSAGNARLRWRKLVSGFMLAMTGVCALVAVAALFFI |
JGI12635J15846_103992341 | 3300001593 | Forest Soil | MNSGLRWRKFMSNFMLTMTGVCALVAVSALFFILGYLVYNG |
JGI12053J15887_103083842 | 3300001661 | Forest Soil | MNSRLRWRKFVSGFMLSMTGVCALISVSVLFFILGYLV |
JGIcombinedJ26739_1003100191 | 3300002245 | Forest Soil | MSPRLRWRKLVSGFMLTMTCVCALVTVSVLFFILGYLVYHGG |
JGIcombinedJ26739_1006947552 | 3300002245 | Forest Soil | MSPRLRWRKFVSGFMLTMTGVCALVAVSVLFFILGYLVY |
Ga0066684_109665781 | 3300005179 | Soil | MTARLRWRKLVSGFMLTMTGVCALIAVSVLFLILGHLVYNGGTS |
Ga0070681_116279602 | 3300005458 | Corn Rhizosphere | MSPRLRWRKFVSGFMLTMTAVCALVAVSALFFILGYLVYHGGT |
Ga0066695_104500052 | 3300005553 | Soil | MTARLRFRKLVSAVMLSLTGVCAFVAVSVLFFILGYLA |
Ga0066703_106134812 | 3300005568 | Soil | MNPRLQWRKLVSGFMLTMTGVCALVAVSVLFFILGYFVYNGG |
Ga0066706_102581963 | 3300005598 | Soil | MSPRLRWRKFVSGFMLTMTGVCAMVAVSVLFLILGYLAIHGGASV |
Ga0066789_102848092 | 3300005994 | Soil | LNNARLKWRKFVSNFMLTMTGVCAFVSVSVLFLILGYL |
Ga0075023_1004446001 | 3300006041 | Watersheds | MSETPMNPRLRWRKFVSNFMLTMTGVCAFVAVSVLFFILGYLVIHGGAS |
Ga0070712_1012892112 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNRLRWRKFVSGLMLTMTGVCAFIAVSVLFLILGYLVYN |
Ga0070765_1000212561 | 3300006176 | Soil | MSNGRLRWRKFISNFMLAMTGVCAFVSVLVLFFILGYLLF |
Ga0075425_1001753054 | 3300006854 | Populus Rhizosphere | MSLRLRWRKCVSAFMLSMTGVCAVVAVSALFLILS |
Ga0099791_106648912 | 3300007255 | Vadose Zone Soil | MSNGRLRWRKFVSNFMLAMTGVCAFVSVLVLFFILGYLL |
Ga0099792_104322951 | 3300009143 | Vadose Zone Soil | MNSRLRWRKFVSNFMRTMTGVCAVVSVSVLFFILGY |
Ga0126380_108166402 | 3300010043 | Tropical Forest Soil | MNARLRWRKAVSGFMLTLTGVCAVVAVSTLFLILGYLVYHGGT |
Ga0126380_108568912 | 3300010043 | Tropical Forest Soil | MNVRLRWRKLVSGFMLTLTGVCAAISVSALFLILG |
Ga0126373_129075082 | 3300010048 | Tropical Forest Soil | MDARLRWRKFVSNFMLAMTGVCAFVSVLVLFLILGYLVF |
Ga0074044_106405031 | 3300010343 | Bog Forest Soil | MNARLRWRKFVSNFMLTMTGVCALVSVAVLFFILGCLV |
Ga0126376_113708711 | 3300010359 | Tropical Forest Soil | MNARLRWRKLVSAFMLTMTGVCAVVAVAVLFFILGYLVFH |
Ga0126372_111654381 | 3300010360 | Tropical Forest Soil | MSARLRWRKFLSAFMLGMTGVCTVVSVSVLFFILGYLLYHG |
Ga0126381_1023303591 | 3300010376 | Tropical Forest Soil | MNARLRWRKFVSGFMLTMTGVCAAVSVSALFLILGYLV |
Ga0126383_112351921 | 3300010398 | Tropical Forest Soil | MTARLRWRKLVSNFMLTLTGICAAVAVSALFFILGY |
Ga0137392_114484121 | 3300011269 | Vadose Zone Soil | MSARLRWRKFVSGFMLTMTGVCAVVAVSVLFFILGYL |
Ga0137393_111837812 | 3300011271 | Vadose Zone Soil | MSLRLRWRKFVSGFMLTMTGVCALVAVSVLFFILGYLVY |
Ga0137389_118444981 | 3300012096 | Vadose Zone Soil | MSPRLRWRKFVSGFMLTMTGVCALVAVSVLFFILGYLVYH |
Ga0137399_100802583 | 3300012203 | Vadose Zone Soil | MTARLRWRKFLSGLMLTMTGVCALVAVSVLFFILGYLVY |
Ga0137399_114657511 | 3300012203 | Vadose Zone Soil | MSPRLRWRKFVSGFMLTLTGVCATVAVSVLFFILGYL |
Ga0137362_110382272 | 3300012205 | Vadose Zone Soil | MSLRLRWRKFVSGFMLTMTGVCALVAVSVLFFILG |
Ga0137366_101935713 | 3300012354 | Vadose Zone Soil | SARLRWRKFVSGFMLTMTGVCAVVAVSVLFFILG* |
Ga0137390_104215431 | 3300012363 | Vadose Zone Soil | MNSRLRWRKFVSNFMLTMTGVCALVSVSVLFFILGYL |
Ga0137390_112044201 | 3300012363 | Vadose Zone Soil | MSPRLRWRKFVSGFMLTMTGVCALIAVSVLFLILGYLA |
Ga0137395_104238262 | 3300012917 | Vadose Zone Soil | MSPRLRWRKFVSGFMLTLTGVCATVAVSVLFFILGY |
Ga0137396_109665902 | 3300012918 | Vadose Zone Soil | MTPRLRWRKFVSGFMLTMTGVCALVSVSVLFFILGHLVY |
Ga0137394_106004422 | 3300012922 | Vadose Zone Soil | MNARLRWRKLVSGFMLTMTGICAAVAVSVLFFILGYFV |
Ga0137413_101730761 | 3300012924 | Vadose Zone Soil | MSPRLRWRKFVSGFMLTMTGVCALVAVSVLFLILGYLA |
Ga0164301_109795502 | 3300012960 | Soil | MNPRLRWRKFVSNFMLTMTCCCALIAVSVLFFILGNLVY |
Ga0126369_106832131 | 3300012971 | Tropical Forest Soil | MNGRLRWRKLVSAFMLTMTGVCALVAVSVLFFILG |
Ga0181527_12228992 | 3300014153 | Bog | MTARVKWRRFVSNFMLTLTGVCALVSVSVLFFILGYLVFNGG |
Ga0137420_10954611 | 3300015054 | Vadose Zone Soil | MNSRLRWRKFVSGFMLTMTGVCALVSVSVLFFILGHLVYH |
Ga0137420_12226124 | 3300015054 | Vadose Zone Soil | VSARLRWRKFVSGFMLAMTGVCALVSVSVLFLILG |
Ga0137412_108176761 | 3300015242 | Vadose Zone Soil | MSPRLRWRKFVSGFMLTMTGVCALVAVSVLFLILG |
Ga0134073_101936371 | 3300015356 | Grasslands Soil | MNTRLRWRKFVSAFMLSMTGVCAVVAVSALFLILSYLVYHGGTA |
Ga0182038_112905292 | 3300016445 | Soil | MAARLRWRKFVSNLMLTMTGVCAFVSVAVLFFILGYLLFN |
Ga0181505_103709132 | 3300016750 | Peatland | MSARVKWRRFVSNFMLTLTGVCALVSVSVLFFILGYLIF |
Ga0187804_100981032 | 3300018006 | Freshwater Sediment | MSGRLRWRKFVSNFMLTLTGVCAFVSVAVLFFILGYLLFNG |
Ga0187766_110135431 | 3300018058 | Tropical Peatland | MTMNAQLRWRKFVSNFMLTMTGVCALISVSVLFFILGYLVY |
Ga0187784_116312161 | 3300018062 | Tropical Peatland | MSARVKWRRFVSDFMLTLTGICALVSVSVLFFILGYLVFNG |
Ga0187769_114216771 | 3300018086 | Tropical Peatland | MSARLRWRKFVSNFMLTMTGVCAVVSVSVLFLILGYLVYHGGTSID |
Ga0182028_10072802 | 3300019788 | Fen | MSARVKWRRFVSNFMLTLTGLCALVCVSVLFLILGYLVFNG |
Ga0193724_10534292 | 3300020062 | Soil | MTARLRWRKLVSAFMLTMTGICALVAVSVLFFILGYFVYN |
Ga0187768_10166813 | 3300020150 | Tropical Peatland | MGARLRWRKFVSNFMLTMTGVCAVVSVIALFLILGYLVFNGGTSVN |
Ga0179594_103577012 | 3300020170 | Vadose Zone Soil | MSPRLRWRKFVSGFMLTMTGVCALVAVSVLFFILGYL |
Ga0210403_104803211 | 3300020580 | Soil | MSSRLRWRKFVSGFMLTMTGVCAFVSVAVLFFILGY |
Ga0210399_104784311 | 3300020581 | Soil | MSPRLRWRKFVSGFMLTMTGVCALVAVSVLFFILG |
Ga0210401_110039422 | 3300020583 | Soil | MSSRLRWRKFVSGFMLTMTGVCAFVSVAVLFFILGYLIYHGGTSI |
Ga0210404_105545051 | 3300021088 | Soil | MNSRLRWRKFVSGFMLTMTGLCALVSVSVLFLILGYLVYHGGTS |
Ga0210406_107253431 | 3300021168 | Soil | VTTGRVRWRKFVSNFMLTLTGVCAVISVSVLFLILG |
Ga0210406_112499441 | 3300021168 | Soil | LTTGKVRWRKFVSNFMLTLTGVCAVISVSVLFLILGY |
Ga0210405_100709324 | 3300021171 | Soil | MSETPMNPRLRWRKFVSNFMLTMTGVCALVAVSVLF |
Ga0210405_106087391 | 3300021171 | Soil | MSNGRLRWRKFVSNFMLAMTGVCAFVSVLVLFFILGYLLFNG |
Ga0210396_114951371 | 3300021180 | Soil | MSSRLRWRKFVSGFMLTMTGVCAVVAVAVLFFILGYLVY |
Ga0179585_11286792 | 3300021307 | Vadose Zone Soil | MNSRLRWRKFVSRFMLTMTGVCALVSVSVLFFILGHLVYHGG |
Ga0210393_101835113 | 3300021401 | Soil | MNRRLRWRKFVSNFMLSMTGVCAFVAVSVLFFILGSLVYHGGTSI |
Ga0210387_111558951 | 3300021405 | Soil | MNARLRWRKFVSNFMLAMTGVCAVVSVGVLFLILGYLLYNG |
Ga0210384_115408092 | 3300021432 | Soil | MSARLRWRKFVSNFMLGLTGVCALVSVGVLFLILGYLLYNGGT |
Ga0210390_108082072 | 3300021474 | Soil | MNSRLRWRKFASNFMLTMTGLCAVVAVSVLFFILGYLVYYGG |
Ga0126371_111911271 | 3300021560 | Tropical Forest Soil | MQARLQWRKFVSNFMLTMTAVCAFVSVAVLFFILGYLLFN |
Ga0247688_10050171 | 3300024186 | Soil | MTGRLKWRKFVSGFMLTMTGVCAVVAVSVLFLILG |
Ga0247665_10481452 | 3300024219 | Soil | MNPRLRWRKFVSNFMLTMTCCCALIAVSVLFFILGNLVYH |
Ga0208479_10793401 | 3300025474 | Arctic Peat Soil | MNRARLHWRKFVSNFMLTMTGLCALISVSALFFIL |
Ga0208714_10442061 | 3300025527 | Arctic Peat Soil | MNNARLHWRKFVSNFMLTMTGLCAFTSVSALFFILGYLLFNGGIGT |
Ga0207665_115552822 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTALPVAPMSARLRWRKFVSGFMLTLTGVCAVVAVSVLFLILGY |
Ga0209265_11402042 | 3300026308 | Soil | MNTRLRWRKFVSAFMLSMTGVCAVVAVSALFLILSYLVYHGGTAVSWS |
Ga0209802_11820151 | 3300026328 | Soil | MSARLRWRKFVSGFMLTMTGVCALVAVSVLCFILGYLVF |
Ga0209473_10802951 | 3300026330 | Soil | MNTRLRWRKFVSAFMLSMTGVCAVVAVSALFLILSYLVYHGGT |
Ga0209806_11472102 | 3300026529 | Soil | MSPRLRWRKFVSGFMLTMTGVCAMVAVSVLFLILGYLAV |
Ga0209807_12803042 | 3300026530 | Soil | MSPRLRWRKFVSGFMLTMTGVCAMVAVSVLFLILGYLAIHGGA |
Ga0209648_100580911 | 3300026551 | Grasslands Soil | MSPRLRWRKFVSGFMLTMTGLCALVAVSVLFFILRY |
Ga0209577_108405252 | 3300026552 | Soil | MSPRLRWRKFVSGFMLTMTGVCAMVAVSVLFLILG |
Ga0207725_1077602 | 3300026692 | Tropical Forest Soil | MGGRLRWRKFVSNFMLTLTGVCAGVSVAVLFFILG |
Ga0207763_10110491 | 3300026879 | Tropical Forest Soil | MGGRLRWRKFVSNFMLTLTGVCAGVSVAVLFFILGYLLF |
Ga0207852_10016361 | 3300026959 | Tropical Forest Soil | MAARLRWRKFVSNFMLTLTGVCAFVSVAVLFFILGYLLFN |
Ga0207819_10491702 | 3300027024 | Tropical Forest Soil | MKGARLQWRKFVSNFMLTMTGICAFISVSALFFIL |
Ga0207508_1027131 | 3300027473 | Soil | MNPRLRWRKFVSNFMLTMTCCCALIAVSVLFFILGNL |
Ga0209735_10317752 | 3300027562 | Forest Soil | MSGRLRWRKFVSGFMLTMTGVCAVVAVAVLFFILG |
Ga0209219_10946671 | 3300027565 | Forest Soil | MSPRLRWRKFVSGFMLTMTGVCALVAVSALFFILGYLVY |
Ga0209009_10184211 | 3300027667 | Forest Soil | MSNRLRWRKFVSHFMLTMTGLCALVAVAVLFFILGYL |
Ga0209038_100766031 | 3300027737 | Bog Forest Soil | MTARLRYRKFVSGFMLGMTGLAAFITVSVLFFILGYLVYHGGTSI |
Ga0209693_101249233 | 3300027855 | Soil | MSPRLRWRKFVSGFMLTLTGICAVVAVAVLFFILG |
Ga0209579_106531582 | 3300027869 | Surface Soil | MPARNARLRWRKFVSGFMLTMTGVCAIVAVAVLFFILGYLVYH |
Ga0209526_105584691 | 3300028047 | Forest Soil | MSNRLRWRKFVSHFMLTMTGLCALVAVAVLFFILGYLV |
Ga0247684_10801242 | 3300028138 | Soil | MTGRLKWRKFVSGFMLTMTGVCAVVAVSVLFLILGYLIYNGGTSINWN |
Ga0247684_10802751 | 3300028138 | Soil | MSSGRLRWRKFVSNFMLAMTGVCAFLSVLVLFFILGYLVFNGGT |
Ga0268264_122665541 | 3300028381 | Switchgrass Rhizosphere | MNARLRWRKLVSAFMLTMTGVCALVAVSVLFFILGYL |
Ga0265338_104856581 | 3300028800 | Rhizosphere | MPAMSARLRWRKFVSGFMLTMTGLCALVAVAVLFF |
Ga0222749_102356821 | 3300029636 | Soil | MTMNAQLRWRKFVSNFMLTMTGVCALISVSVLFFIL |
Ga0302184_103864032 | 3300030490 | Palsa | MTARLRYRKFVSGFMLGMTGLAALITVSVLFFILGYLVYHGGTS |
Ga0170820_122812212 | 3300031446 | Forest Soil | MSRRLRWRQFVSYFMLTMTGLCALVAKAVLFFILGYLVY |
Ga0318538_107626552 | 3300031546 | Soil | MQARLQWRKFVSNFMLTMTAVCAFVSVAVLFFILGYL |
Ga0307476_104236542 | 3300031715 | Hardwood Forest Soil | MTARLRYRKFVSGFMLGMTGLAALITVSVLFFILGYLVYHGGTSI |
Ga0307469_111107611 | 3300031720 | Hardwood Forest Soil | MSPRLRWRKFVSGFMLTMTGVCAIVAVAVLFFILGY |
Ga0307469_117289412 | 3300031720 | Hardwood Forest Soil | MSARLRWRKFVSNFMLTMTGICAVVSVAILFLILGYL |
Ga0318500_106207042 | 3300031724 | Soil | MNARLKWRKLVSAFMLTMTGVCAVVAVAVLFFILG |
Ga0302321_1014485412 | 3300031726 | Fen | MTARNRGRNAINNIMLSLTGVCAFLAVSTLFFTLGYLLYNGGKSL |
Ga0307477_100907231 | 3300031753 | Hardwood Forest Soil | MSPQLRWRKFVSGFMLTMTGVCALVAVSVLFFILGYLVY |
Ga0307475_101311953 | 3300031754 | Hardwood Forest Soil | MSPRLRWRKFVSGFMLTMTGVCALIAVSVLFFILGYL |
Ga0307475_108999842 | 3300031754 | Hardwood Forest Soil | MNARLRWRKFVSNFMLTMTGVCAVVSVCVLFFILGCLIYQGGTSIN |
Ga0318554_102384282 | 3300031765 | Soil | MQARLQWRKFVSNFMLTMTGVCAFVSVAVLFFILGYLLFNGGTSIN |
Ga0318547_109200292 | 3300031781 | Soil | MAARLRWRKFVSNFMLTLTGVCAFVSVAVLFFILGY |
Ga0307473_108440811 | 3300031820 | Hardwood Forest Soil | MNARLKWRKFVSAFMLTMTGVCALVAVSVLFFILGYL |
Ga0307478_111485481 | 3300031823 | Hardwood Forest Soil | MNARLRWRKFVSNFMLTMTGVCAVVSVAVLFLILGCLIYQGGTSINWNFF |
Ga0307478_115983882 | 3300031823 | Hardwood Forest Soil | MSSRLRWRKFVSSFMLTMTGVCALVAVSVLFLILGYLDYHGGT |
Ga0306925_122745331 | 3300031890 | Soil | MNARLRWRKLLSGFMLTMTGVCAIVTVSVLFFILGY |
Ga0318520_106080652 | 3300031897 | Soil | MSTRLRWRKFLSNLMLTMTGLCALISVSALFFILGYLLFN |
Ga0306923_106440361 | 3300031910 | Soil | MAARLRWRKFVSNLMLTMTGVCAFVSVAALFFILGYLLFN |
Ga0306923_116901311 | 3300031910 | Soil | MQARLQWRKFVSNFMLTMTAVCAFVSVAVLFFILGYLLFNGGT |
Ga0310910_105255011 | 3300031946 | Soil | MEGRLRWRKLLSDFMLTLTGVCAFISVAALFCILGYLLFNGGTSIN |
Ga0318531_103571971 | 3300031981 | Soil | MQARLQWRKFVSNFMLTMTAVCAFVSVAVLFFILG |
Ga0306922_113478772 | 3300032001 | Soil | MAARLRWRKFVSNLMLTMTGVCAFVSVAVLFFILGYLLFNGGTS |
Ga0310911_101067813 | 3300032035 | Soil | MNARLRWRKLVSNFMLTMTGVCAFVSVAVLFFILGYLLFNGGT |
Ga0310911_101418093 | 3300032035 | Soil | MNARLRWRKFVSGFMLTMTGVCAAVSVSALFLILGYLVVRGGASIN |
Ga0310911_101589191 | 3300032035 | Soil | MSTRLRWRKFLSNLMLTMTGLCALISVSALFFILGYLLFNGGTS |
Ga0307472_1009510312 | 3300032205 | Hardwood Forest Soil | MSSRLRWRKFVSGFMLTMTGVCALVSVSALFFILGYLVYN |
Ga0307472_1010522782 | 3300032205 | Hardwood Forest Soil | MSARLRWRKFVSNFMLTMTGICAVVSVAILFLILGYLL |
Ga0335078_125201062 | 3300032805 | Soil | MNARLRWRKFVSNFMLTMTGVCAFVSVAVLFFILGYL |
Ga0310914_103110323 | 3300033289 | Soil | MAARLRWRKFVSNLMLTMTGVCAFVSVAALFFILGYLLFNGGT |
Ga0326728_101496711 | 3300033402 | Peat Soil | MSARIKWRRFVSNFMLTLTGVCAIVSVSVLFFILG |
Ga0371488_0521290_415_534 | 3300033983 | Peat Soil | MSAGVKWRRFVSNFMLTLTGLCALVSVSVLFFILGYLVFN |
⦗Top⦘ |