NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027473

3300027473: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK08-D (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027473 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0091533 | Ga0207508
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-HINK08-D (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21528187
Sequencing Scaffolds6
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1
All Organisms → cellular organisms → Bacteria → Acidobacteria3
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000549Metagenome / Metatranscriptome1036Y
F013370Metagenome272Y
F061114Metagenome / Metatranscriptome132Y
F068069Metagenome / Metatranscriptome125Y
F075147Metagenome / Metatranscriptome119Y
F083123Metagenome / Metatranscriptome113Y
F095080Metagenome105N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207508_100710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
Ga0207508_101474All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
Ga0207508_101525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
Ga0207508_101778All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
Ga0207508_101826All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
Ga0207508_102713All Organisms → cellular organisms → Bacteria515Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207508_100710Ga0207508_1007102F013370LSTGSLCASISGSNCNFASWNPDFDMLMIVANGNGGQIDPGNSIQIDNNFSYQGGLYGTNAVEFGNNVNVDGPIVGSQIILSNNLTTNAFPNISIVPVGMPSNEEVYAQPNPPQGFTG
Ga0207508_101474Ga0207508_1014742F083123KQLVLEDATRKETVATLDAKVDDHGELLSMPTVLFLDRGGYNFASGDVLKISATYDNTTGKSLRDGAMGIVVGYFVPTDDSVMAALRRKPAAHKMAGMSHDQ
Ga0207508_101525Ga0207508_1015251F000549SQFKAERSRHRAEARSSMVFGVPLFLRTLLRLVFVCRHRHKGPPITLREAIPSNLLGYQAVYGRGTYVTCLDCGQKFAYNHKTSRLVDFWGVHDAEALAGVRRRVIEFFSSLRGLAARLGRLKVRTPISEHVRSVPRLGILTKGQ
Ga0207508_101778Ga0207508_1017781F075147VKGGTGTMIMRSGEQWHCTNSVCHCRVVVQLNSHIEGGNPRCVCGAPMKKQYAPPNLTYLEFLRVEDPVPARDGSRKG
Ga0207508_101826Ga0207508_1018262F068069TNNVNLSAMTPPPPHSGRPRYKVVFGKDAQDLEAKLNDPVFTPAGYAVTHLAFNSARAEYLLILEDERNNQS
Ga0207508_101875Ga0207508_1018752F095080MCVAMAATKITVVASAPTTDLQLVLSPVRSFARLVEVERRIQSLPTVRSLYVRDFRGGIATLTVALRSPMTTEEFASGLRVIDEPQLRLVSGTRNVLEFRIEGEASIA
Ga0207508_102713Ga0207508_1027131F061114MNPRLRWRKFVSNFMLTMTCCCALIAVSVLFFILGNL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.