Basic Information | |
---|---|
Family ID | F062578 |
Family Type | Metagenome |
Number of Sequences | 130 |
Average Sequence Length | 45 residues |
Representative Sequence | MATTVITGRDISLSFTGGTDIEAQATNAVLTKVNERQTYQTLDG |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 99.23 % |
% of genes from short scaffolds (< 2000 bps) | 90.77 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (53.077 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.538 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.308 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (48.462 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 47.73% Coil/Unstructured: 52.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 3.85 |
PF04586 | Peptidase_S78 | 1.54 |
PF04860 | Phage_portal | 1.54 |
PF03354 | TerL_ATPase | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 3.85 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 1.54 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.46 % |
Unclassified | root | N/A | 11.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002277|B570J29592_103232 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 760 | Open in IMG/M |
3300002297|B570J29603_103206 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1173 | Open in IMG/M |
3300002835|B570J40625_101340666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300003277|JGI25908J49247_10120932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300003394|JGI25907J50239_1100620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300003394|JGI25907J50239_1117752 | Not Available | 516 | Open in IMG/M |
3300003430|JGI25921J50272_10092853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300003430|JGI25921J50272_10107795 | Not Available | 589 | Open in IMG/M |
3300004124|Ga0066178_10119071 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 729 | Open in IMG/M |
3300005517|Ga0070374_10528816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300005585|Ga0049084_10117663 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300005662|Ga0078894_11097015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300005943|Ga0073926_10033278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
3300006030|Ga0075470_10185381 | Not Available | 599 | Open in IMG/M |
3300006802|Ga0070749_10120908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1538 | Open in IMG/M |
3300006802|Ga0070749_10552276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300006803|Ga0075467_10310392 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 838 | Open in IMG/M |
3300006805|Ga0075464_10500927 | Not Available | 743 | Open in IMG/M |
3300006863|Ga0075459_1069175 | Not Available | 599 | Open in IMG/M |
3300006917|Ga0075472_10655483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300007234|Ga0075460_10314034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300007555|Ga0102817_1123042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300008108|Ga0114341_10416447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300008264|Ga0114353_1380004 | Not Available | 532 | Open in IMG/M |
3300008266|Ga0114363_1246189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300008267|Ga0114364_1109882 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 841 | Open in IMG/M |
3300008450|Ga0114880_1132685 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 920 | Open in IMG/M |
3300008450|Ga0114880_1195575 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 683 | Open in IMG/M |
3300009111|Ga0115026_11955652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300009146|Ga0105091_10041050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2040 | Open in IMG/M |
3300009165|Ga0105102_10444437 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 696 | Open in IMG/M |
3300009168|Ga0105104_10419959 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 745 | Open in IMG/M |
3300009169|Ga0105097_10331051 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 843 | Open in IMG/M |
3300009194|Ga0114983_1091746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300009466|Ga0126448_1022840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1495 | Open in IMG/M |
3300009504|Ga0114946_10568746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300010316|Ga0136655_1184424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300010354|Ga0129333_10603646 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 952 | Open in IMG/M |
3300010354|Ga0129333_11201722 | Not Available | 630 | Open in IMG/M |
3300011010|Ga0139557_1042320 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 786 | Open in IMG/M |
3300012017|Ga0153801_1050194 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 735 | Open in IMG/M |
3300013004|Ga0164293_10477913 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 826 | Open in IMG/M |
3300013372|Ga0177922_10718439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300017774|Ga0181358_1246450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300017777|Ga0181357_1308141 | Not Available | 536 | Open in IMG/M |
3300017778|Ga0181349_1005446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5377 | Open in IMG/M |
3300017780|Ga0181346_1219217 | Not Available | 678 | Open in IMG/M |
3300018815|Ga0187845_1255871 | Not Available | 555 | Open in IMG/M |
3300019784|Ga0181359_1147906 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 809 | Open in IMG/M |
3300019784|Ga0181359_1180626 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 697 | Open in IMG/M |
3300019784|Ga0181359_1219476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300020159|Ga0211734_10659763 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 690 | Open in IMG/M |
3300020161|Ga0211726_10795679 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 923 | Open in IMG/M |
3300020221|Ga0194127_10555037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300020506|Ga0208091_1023202 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 714 | Open in IMG/M |
3300020527|Ga0208232_1004220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2424 | Open in IMG/M |
3300020566|Ga0208222_1059255 | Not Available | 664 | Open in IMG/M |
3300021963|Ga0222712_10167320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1468 | Open in IMG/M |
3300021963|Ga0222712_10365216 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 886 | Open in IMG/M |
3300022176|Ga0212031_1090114 | Not Available | 524 | Open in IMG/M |
3300022179|Ga0181353_1150754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300022198|Ga0196905_1152992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300022200|Ga0196901_1225612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300022407|Ga0181351_1127362 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 946 | Open in IMG/M |
3300024506|Ga0255168_1072560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300024513|Ga0255144_1077842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300025075|Ga0209615_110488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300025080|Ga0209103_1043530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300025585|Ga0208546_1115348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300025645|Ga0208643_1145602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300025732|Ga0208784_1107418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300025896|Ga0208916_10026666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2306 | Open in IMG/M |
3300025896|Ga0208916_10049501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1722 | Open in IMG/M |
3300027128|Ga0255099_1068514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300027140|Ga0255080_1022699 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1030 | Open in IMG/M |
3300027396|Ga0255146_1117713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300027581|Ga0209651_1114862 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 750 | Open in IMG/M |
3300027642|Ga0209135_1236758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300027732|Ga0209442_1096805 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1194 | Open in IMG/M |
3300027732|Ga0209442_1223125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300027743|Ga0209593_10087131 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1160 | Open in IMG/M |
3300027746|Ga0209597_1365679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300027756|Ga0209444_10123671 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1025 | Open in IMG/M |
3300027764|Ga0209134_10161429 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 772 | Open in IMG/M |
3300027770|Ga0209086_10244461 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 797 | Open in IMG/M |
3300027785|Ga0209246_10168462 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 860 | Open in IMG/M |
3300027793|Ga0209972_10027205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3371 | Open in IMG/M |
3300027798|Ga0209353_10141077 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1077 | Open in IMG/M |
3300027805|Ga0209229_10027850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2465 | Open in IMG/M |
3300027808|Ga0209354_10100841 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1178 | Open in IMG/M |
3300027808|Ga0209354_10175076 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300027900|Ga0209253_11085854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300027956|Ga0209820_1046039 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1150 | Open in IMG/M |
3300027971|Ga0209401_1049329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1917 | Open in IMG/M |
3300028025|Ga0247723_1091938 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 779 | Open in IMG/M |
3300029169|Ga0168037_113080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300031539|Ga0307380_11360064 | Not Available | 538 | Open in IMG/M |
3300031565|Ga0307379_10560801 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1055 | Open in IMG/M |
3300031787|Ga0315900_10959377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300031787|Ga0315900_11088414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300031857|Ga0315909_10028246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5491 | Open in IMG/M |
3300031997|Ga0315278_10737630 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 999 | Open in IMG/M |
3300031999|Ga0315274_10307312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1889 | Open in IMG/M |
3300032053|Ga0315284_11522532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300032093|Ga0315902_10066837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4044 | Open in IMG/M |
3300032093|Ga0315902_10166685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2266 | Open in IMG/M |
3300032116|Ga0315903_10034162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5392 | Open in IMG/M |
3300032118|Ga0315277_10534762 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1166 | Open in IMG/M |
3300033980|Ga0334981_0108116 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1371 | Open in IMG/M |
3300033993|Ga0334994_0359934 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 716 | Open in IMG/M |
3300033993|Ga0334994_0458054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
3300033993|Ga0334994_0484025 | Not Available | 578 | Open in IMG/M |
3300034019|Ga0334998_0669085 | Not Available | 557 | Open in IMG/M |
3300034061|Ga0334987_0608273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300034062|Ga0334995_0397168 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 864 | Open in IMG/M |
3300034064|Ga0335001_0535211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300034066|Ga0335019_0162780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1463 | Open in IMG/M |
3300034073|Ga0310130_0137513 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 744 | Open in IMG/M |
3300034082|Ga0335020_0619481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300034092|Ga0335010_0304542 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 913 | Open in IMG/M |
3300034092|Ga0335010_0543029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300034102|Ga0335029_0522061 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 684 | Open in IMG/M |
3300034102|Ga0335029_0695582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300034105|Ga0335035_0355347 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 846 | Open in IMG/M |
3300034106|Ga0335036_0655474 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 628 | Open in IMG/M |
3300034112|Ga0335066_0055413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2629 | Open in IMG/M |
3300034119|Ga0335054_0775560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300034120|Ga0335056_0658841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300034167|Ga0335017_0073163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2023 | Open in IMG/M |
3300034168|Ga0335061_0648846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.92% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.62% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.62% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.85% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.85% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.08% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.08% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.31% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.31% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.31% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.54% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.54% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.54% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.77% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.77% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.77% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.77% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.77% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.77% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.77% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.77% |
Aquarium Water | Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water | 0.77% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.77% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.77% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.77% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002277 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002297 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025080 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - 4C3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027128 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d | Environmental | Open in IMG/M |
3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300029169 | Aquariaum water viral communities from Chicago, USA - Oceanarium - OC1 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29592_1032321 | 3300002277 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMEGEA |
B570J29603_1032061 | 3300002297 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTLEGEAYK |
B570J40625_1013406661 | 3300002835 | Freshwater | MATVVITGRDISLSFTGGTDIEAQATNAVLTKVLDRQVYQTLDGE |
JGI25908J49247_101209321 | 3300003277 | Freshwater Lake | MATTVITGRDISLSFTGGTDIEAQATNAVLTKVNERQTYQTL |
JGI25907J50239_11006201 | 3300003394 | Freshwater Lake | MATQVITGRDVSLSFSGSLGTDIDAQALSATLTKTIDRQTYQTLDGEAYKTTN |
JGI25907J50239_11177521 | 3300003394 | Freshwater Lake | MATQVITGRDVSLSFSGSLGTDIDAQALSATLTKTMDRQVYXTLDGXAYKVVNVEAEFTMEILAD |
JGI25921J50272_100928531 | 3300003430 | Freshwater Lake | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTLDGEAYKTTNISGT |
JGI25921J50272_101077952 | 3300003430 | Freshwater Lake | MATTVITGRDVGLSFTGGTDIQAQATNAVLTKVNDRQVYQTMDGXAXKTXNXSLQHSS* |
Ga0066178_101190711 | 3300004124 | Freshwater Lake | MATQVITGRDVSLSFSGSLGTDIDAQALSATLTKTMDRQVYQTLDGEAYKVVN |
Ga0070374_105288162 | 3300005517 | Freshwater Lake | MATTVITGRDISLSFTGGTDIEAQATNAVLTKVNERQTY |
Ga0049084_101176633 | 3300005585 | Freshwater Lentic | MATTVITGRDISLSFTGGTDIEAQATSAILTKVLERQT |
Ga0078894_110970151 | 3300005662 | Freshwater Lake | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMDGEAYKTTNVSG |
Ga0073926_100332781 | 3300005943 | Sand | MATTVITGRDISLSFTGGTDIEAQATNAVLTKVLDRQTYQTLDGEAYK |
Ga0075470_101853811 | 3300006030 | Aqueous | VATTVITGRNISLSFTGGTDIEAQATSAVLTKVNERQTYQTLDGEAY |
Ga0070749_101209084 | 3300006802 | Aqueous | VATTVITGRDITLSFTGGTDIEAQATSAVLTKVNERQTYQTLDGEAY |
Ga0070749_105522761 | 3300006802 | Aqueous | VATTVITGRDISLSFTGGTDIEAQATNAVLTKTHVRETYQTLDGEAY |
Ga0075467_103103921 | 3300006803 | Aqueous | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNDRQVYQTLDGEA |
Ga0075464_105009273 | 3300006805 | Aqueous | VATQVITGRNISLSFTGGTDIEAQATSAVLTKVNERQTYQ |
Ga0075459_10691752 | 3300006863 | Aqueous | VATTVITGRNISLSFTGGTDIEAQATSAVLTKVNERQTYQTLDG |
Ga0075472_106554832 | 3300006917 | Aqueous | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMDG |
Ga0075460_103140341 | 3300007234 | Aqueous | VATTVITGRDISLSFTGGTDIEAQATNAVLTKTHVRETYQT |
Ga0102817_11230422 | 3300007555 | Estuarine | MATTVITGRDISLSFTGGTDIEAQATNAVLTKVNERQTYQTLDG |
Ga0114341_104164471 | 3300008108 | Freshwater, Plankton | MATVVITGRDVGLSFSGGTDIQAQATNAVLTKVNERQVYQTMEGEAYKTTNIS |
Ga0114353_13800041 | 3300008264 | Freshwater, Plankton | VATVVITGRDVSLSFTGGTDIEAQATNAVLTKTNVRETYQTLDGEAY |
Ga0114363_12461892 | 3300008266 | Freshwater, Plankton | VATTVITGRDISLSFTGGTDIEAQATNAVLTKTNVRETYQTL |
Ga0114364_11098821 | 3300008267 | Freshwater, Plankton | MATTVITGRDVSLSFTGGTDVEAQATSAVLTKTNVRETYQTLDGE |
Ga0114880_11326851 | 3300008450 | Freshwater Lake | MATTVITGRDVGLSFTGGTDIQAQATNAVLTKVNDRQVYQTMDGEAY |
Ga0114880_11955753 | 3300008450 | Freshwater Lake | MATVVITGRDVSLSFTGGTDIEAQATSAVLTKTNVRETYQTLDGEAY |
Ga0115026_119556522 | 3300009111 | Wetland | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNDRHV |
Ga0105091_100410501 | 3300009146 | Freshwater Sediment | MATVVITGRDISLSFSGGTDIEAQATSAVLTKTNV |
Ga0105102_104444373 | 3300009165 | Freshwater Sediment | MATTVSTGRDISLSFTGGTDIEAQATNAVLTKEFDRQTY |
Ga0105104_104199593 | 3300009168 | Freshwater Sediment | MATVVITGRDISLSFTGGTDIEAQATNAVLTKVLDRQT |
Ga0105097_103310513 | 3300009169 | Freshwater Sediment | MATVVITGRDVGLSFSGGTDIQAQATNAVLTKVNERQVYQTMEGEAYKTTNI |
Ga0114983_10917463 | 3300009194 | Deep Subsurface | MASVVITGRDISLSFTGGTDIDAQATSAVLTKTNVREVYQTLDGEAVKTVN |
Ga0126448_10228404 | 3300009466 | Meromictic Pond | MATVVITGRDISLSFTGGTDIEAQATSAVLTKTNVRETY |
Ga0114946_105687462 | 3300009504 | Sediment | VATYVITGRDVSLSFAGGTDIDAQATSAVLTKIVDRQVYQTLDGEAYKTTNF |
Ga0136655_11844243 | 3300010316 | Freshwater To Marine Saline Gradient | MATTVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQ |
Ga0129333_106036463 | 3300010354 | Freshwater To Marine Saline Gradient | MATVVITGRDISLSFTGGTDIEAQATSAVLTKVNERQE |
Ga0129333_112017223 | 3300010354 | Freshwater To Marine Saline Gradient | VATVVITGRDVSLSFTGGTDIEAQATNAVLTKTNV |
Ga0139557_10423203 | 3300011010 | Freshwater | MATQVITGRDVSLSFSGSLGTDIDAQALSATLTKTLDRQTYQTLDGEAYKTTNVEAE |
Ga0153801_10501943 | 3300012017 | Freshwater | MATQVITGRDVSLSFSGSLGTDIDAQALSATLTKSIDRQTYQTLDGEAYKTTN |
Ga0164293_104779133 | 3300013004 | Freshwater | MATTVITGRDISLSFTGGTDIEAQATSAILTKVLERQTYQ |
Ga0177922_107184392 | 3300013372 | Freshwater | MATVVITGRDISLSFTGGTDIEAQATSAVLTKVNERQVYQTLEGEAYK |
Ga0181358_12464502 | 3300017774 | Freshwater Lake | MATVVITGRDISLSFTGGTDIEAQATSAILTKVLERQTYQT |
Ga0181357_13081412 | 3300017777 | Freshwater Lake | MATTVLTGRNISLSFTGGTDIEAQATSAVLTKTFD |
Ga0181349_10054466 | 3300017778 | Freshwater Lake | MATTVLTGRNISLSFTGGTDIEAQATSAVLTKTFDR |
Ga0181346_12192173 | 3300017780 | Freshwater Lake | MATQVITGRDVSLSFSGSLGTDIDAQALSATLTKTMDRQVYQTLDGE |
Ga0187845_12558712 | 3300018815 | Freshwater | MATQVITGRDVSLSFSGSLGTDIDAQALSATLTKTIDRQTYQT |
Ga0181359_11479061 | 3300019784 | Freshwater Lake | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMEG |
Ga0181359_11806261 | 3300019784 | Freshwater Lake | MATTVITGRDISLSFTGGTDIEAQATSAILTKVLERQTYQTL |
Ga0181359_12194761 | 3300019784 | Freshwater Lake | VATTVITGRDISLSFTGGTDIEAQATNAVLTKTFVRETYQTLDGEAYK |
Ga0211734_106597633 | 3300020159 | Freshwater | MATTVITGRDISLSFTGGTDIEAQATSAVLTKVNERQAYQTLDGVA |
Ga0211726_107956793 | 3300020161 | Freshwater | MATQVITGRDVSLSFSGSLGTDIDAQALSATLTKTIDRQTYQTLDGEAYKTTNVEAEFTM |
Ga0194127_105550373 | 3300020221 | Freshwater Lake | MATQVITGRDVSLSFSGGTDIEAQATNAVLTKVNERQTYQTMDGEAYKTTNISGTFQLDM |
Ga0208091_10232021 | 3300020506 | Freshwater | MATTVITGRDISLSFTGGTDIEAQATSAILTKVLERQTY |
Ga0208232_10042201 | 3300020527 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTME |
Ga0208222_10592553 | 3300020566 | Freshwater | VATVVITGRDVSLSFTGGTDIEAQATNAVLTKTNVRETYQTLDGEAYK |
Ga0222712_101673204 | 3300021963 | Estuarine Water | MATTVITGRDISLSFTGGTDIEAQATSAILTKVLERQTYQTLDGEAY |
Ga0222712_103652163 | 3300021963 | Estuarine Water | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKTNDRQVYQTMD |
Ga0212031_10901141 | 3300022176 | Aqueous | VATYVITGRDVSLSFSGGTDIDAQATSAVLTKTNDRQVYQTL |
Ga0181353_11507542 | 3300022179 | Freshwater Lake | MATTVITGRDISLSFTGGTDIEAQATSAILTKTNSRETYQT |
Ga0196905_11529921 | 3300022198 | Aqueous | VATYVITGRDVSLSFSGGTDIDAQATSAVLTKTNDRQVYQTLDSEAYKTTNV |
Ga0196901_12256122 | 3300022200 | Aqueous | MATTVITGRDISLSFTGGTDIEAQATNAVLTKVNERQVYQTLD |
Ga0181351_11273623 | 3300022407 | Freshwater Lake | MATTVITGRDISLSFTGGTDIEAQATSAILTKVLERQTYQTLDGEAYKTT |
Ga0255168_10725601 | 3300024506 | Freshwater | MATVVITGRDISLSFTGGTDIEAQATNAVLTKVLDRQTYQTLDGEAYKTTNV |
Ga0255144_10778422 | 3300024513 | Freshwater | MATTVITGRDISLSFTGGTDIEAQALSAVLTKTNVRETYQTLDGE |
Ga0209615_1104882 | 3300025075 | Freshwater | MATTVITGRDISLSFTGGTDIEAQATSAVLTKTNVRETYQTLD |
Ga0209103_10435302 | 3300025080 | Freshwater | MATTVITGRDVSLSFTGGTDIDAQATSAVLTKTNVREVYQ |
Ga0208546_11153481 | 3300025585 | Aqueous | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMDGEAYKTTNISG |
Ga0208643_11456021 | 3300025645 | Aqueous | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMDGEAYKTT |
Ga0208784_11074183 | 3300025732 | Aqueous | VATTVITGRDISLSFTGGTDIEAQATNAVLTKTNVRETY |
Ga0208916_100266661 | 3300025896 | Aqueous | MATVVITGRDISLSFTGGTDIEAQATSAVLTKTNLRETYQ |
Ga0208916_100495011 | 3300025896 | Aqueous | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQV |
Ga0255099_10685141 | 3300027128 | Freshwater | MATTVITGRDVSLSFTGGTDIDAQATSAILTKVNERQAYET |
Ga0255080_10226993 | 3300027140 | Freshwater | MATTVITGRDISLSFTGGTDIEAQATSAILTKVNERQAYETLDGTAYKTTNISGTFA |
Ga0255146_11177131 | 3300027396 | Freshwater | MATVVITGRDISLSFTGGTDIEAQATNAVLTKVLD |
Ga0209651_11148621 | 3300027581 | Freshwater Lake | MATTVITGRDISLSFTGGTDIEAQATSAVLTKVLERQTYQTLDGEAYKT |
Ga0209135_12367582 | 3300027642 | Freshwater Lake | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMEGEAYKTTNISG |
Ga0209442_10968051 | 3300027732 | Freshwater Lake | MATTVITGRDISLSFTGGTDIEAQATSAVLTKVLERQTYQTLDGEAY |
Ga0209442_12231253 | 3300027732 | Freshwater Lake | MATTVITGRNISLSFTGGTDIEAQATSAVLTKTFDRQT |
Ga0209593_100871313 | 3300027743 | Freshwater Sediment | MATVVITGRDISLSFSGGTDIEAQATNAVLTKVNERQVYQTLDGEAYKTTNISG |
Ga0209597_13656791 | 3300027746 | Freshwater Lake | MATQVITGRDINLSFSGSLGTDIDAQALSATLTKTIDRQTYQTLDGEAYKTTNVE |
Ga0209444_101236711 | 3300027756 | Freshwater Lake | MATTVITGRDISLSFTGGTDIDAQATSAVLTKTNVRETYQTLD |
Ga0209134_101614291 | 3300027764 | Freshwater Lake | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVY |
Ga0209086_102444611 | 3300027770 | Freshwater Lake | MATTVITGRDISLSFTGGTDIEAQATNAVLTKVNERQSY |
Ga0209246_101684623 | 3300027785 | Freshwater Lake | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNE |
Ga0209972_100272051 | 3300027793 | Freshwater Lake | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMEGEAYK |
Ga0209353_101410771 | 3300027798 | Freshwater Lake | MATQVITGRDVSLSFSGSLGTDIDAQALSATLTKTMDRQVYQTLDGEAYKVVNVEAE |
Ga0209229_100278501 | 3300027805 | Freshwater And Sediment | MATVVITGRDITLSFTGGTDIDAQATNAVLTKVLDRQVFQ |
Ga0209354_101008411 | 3300027808 | Freshwater Lake | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMEGEAYKTTN |
Ga0209354_101750762 | 3300027808 | Freshwater Lake | MATTVITGRDISLSFTGGTDIEAQATSAVLTKTNLRE |
Ga0209253_110858542 | 3300027900 | Freshwater Lake Sediment | MATTVITGRDISLSFTGGTDIEAQATSAVLTKTVN |
Ga0209820_10460391 | 3300027956 | Freshwater Sediment | MATTVITGRDISLSFTGGTDIEAQATNAVLTKEFDRQTYQT |
Ga0209401_10493294 | 3300027971 | Freshwater Lake | MATTVITGRNISLSFTGGTDIEAQATSAVLTKTFDRQTYQTLDGEAYFVTNV |
Ga0247723_10919383 | 3300028025 | Deep Subsurface Sediment | MATTVITGRDVSLSFTGGTDIDAQATSAILTKVNERQAYETLDGT |
Ga0168037_1130802 | 3300029169 | Aquarium Water | MATTVITGRDISLSFTGGTDIEAQALSAVLTKTNLR |
Ga0307380_113600642 | 3300031539 | Soil | VATYVITGRDVNLSFAGGTDIDAQATSAVLTKTNDRQVYQTLDGE |
Ga0307379_105608011 | 3300031565 | Soil | VATYVITGRDVNLSFAGGTDIDAQATSAVLTKTNDRQVYQTLDGEAYKTTNVESQFDLE |
Ga0315900_109593772 | 3300031787 | Freshwater | VATTVITGRDVSLSFTGGTDIDAQATNAVLTKTNVRETYQT |
Ga0315900_110884142 | 3300031787 | Freshwater | VATTVITGRDISLSFTGGTDIEAQATNAVLTKTQVRETY |
Ga0315909_100282466 | 3300031857 | Freshwater | MATTVITGRDISLSFTGGTDIEAQALSAVLTKTNLRETYQTLDG |
Ga0315278_107376303 | 3300031997 | Sediment | MATTVITGRDISLSFTGGTDIEAQATSAILTKVLERQTYQTLDGEAYK |
Ga0315274_103073124 | 3300031999 | Sediment | MATTVITGRNISLSFTGGTDIEAQATNAVLTKNNVRQAYETLDGVAYKTV |
Ga0315284_115225323 | 3300032053 | Sediment | MATTVITGRDISLSFTGGTDIEAQATSAILTKVNERQAYETLDGTAYKTTSISGSFALSM |
Ga0315902_100668376 | 3300032093 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNDRQVYQTMDGEAYKTVNVSGTFQL |
Ga0315902_101666851 | 3300032093 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMEGEAYKTTNIS |
Ga0315903_100341626 | 3300032116 | Freshwater | MATVVITGRDISLSFTGGTDIEAQATSAVLTKVNERQAYQTLDGVAYK |
Ga0315277_105347621 | 3300032118 | Sediment | MATTVITGRDISLSFTGGTDIEAQATSAILTKVNERQAYETLDGTAYKTTSISGTFALSM |
Ga0334981_0108116_1262_1369 | 3300033980 | Freshwater | MATVVITGRDISLSFSGGTDIEAQATNAVLTKVNER |
Ga0334994_0359934_1_156 | 3300033993 | Freshwater | MATVVITGRDISLSFTGGTDIEAQATSAVLTKVNERQEYQTLDGTAYKTTNI |
Ga0334994_0458054_2_118 | 3300033993 | Freshwater | MATTVITGRDVSLSFTGGTDIEAQATNAVLTKEFDRQTY |
Ga0334994_0484025_3_131 | 3300033993 | Freshwater | MATVVITGRDISLSFTGGTDIEAQATSAVLTKTNLRETYQTLD |
Ga0334998_0669085_406_555 | 3300034019 | Freshwater | MATQVITGRDVSLSFSGSLGTDIDAQAPSATLTKTLDRQVYQTLDGEAYK |
Ga0334987_0608273_488_643 | 3300034061 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMEGEAYKTTNI |
Ga0334995_0397168_741_863 | 3300034062 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQT |
Ga0335001_0535211_3_152 | 3300034064 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMEGEAYKTT |
Ga0335019_0162780_2_106 | 3300034066 | Freshwater | MATTVITGRDISLSFTGGTDIEAQATSAVLTKTNV |
Ga0310130_0137513_638_742 | 3300034073 | Fracking Water | MATVVITGRDISLSFSGGTDIEAQATSAVLTKVNE |
Ga0335020_0619481_1_138 | 3300034082 | Freshwater | MATVVITGRDISLSFTGGTDIEAQATNAVLTKVNERQQYETLDGTA |
Ga0335010_0304542_798_911 | 3300034092 | Freshwater | MATTVITGRDISLSFTGGTDIEAQATSAVLTKTNVRET |
Ga0335010_0543029_3_137 | 3300034092 | Freshwater | MATVVITGRDISLSFTGGTDIEAQATSAVLTKVNERQEYQTLDGT |
Ga0335029_0522061_1_126 | 3300034102 | Freshwater | MATTVITGRDISLSFTGGTDIEAQATSAVLTKVNERQAYQTL |
Ga0335029_0695582_1_147 | 3300034102 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMEGEAYKT |
Ga0335035_0355347_729_845 | 3300034105 | Freshwater | MATTVITGRDISLSFTGGTDIEAQATNAVLTKEFDRQTY |
Ga0335036_0655474_514_627 | 3300034106 | Freshwater | MATVVITGRDISLSFSGGTDIEAQATSAVLTKVNERQV |
Ga0335066_0055413_2485_2628 | 3300034112 | Freshwater | MATVVITGRDITLSFTGGTDIEAQATNAVLTKVLDRQTYQTLDGEAYK |
Ga0335054_0775560_381_506 | 3300034119 | Freshwater | MATTVITGRDISLSFTGGTDIEAQALSAVLTKTNLRETYQTL |
Ga0335056_0658841_416_532 | 3300034120 | Freshwater | MATVVITGRDISLSFTGGTDIEAQATSAVLTKVNERQAY |
Ga0335017_0073163_1863_2021 | 3300034167 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQTMDGEAYKTTNIS |
Ga0335061_0648846_408_527 | 3300034168 | Freshwater | MATVVITGRDVGLSFTGGTDIQAQATNAVLTKVNERQVYQ |
⦗Top⦘ |