Basic Information | |
---|---|
Family ID | F062882 |
Family Type | Metagenome |
Number of Sequences | 130 |
Average Sequence Length | 49 residues |
Representative Sequence | WFRKKLQMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETIKF |
Number of Associated Samples | 64 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.91 % |
% of genes near scaffold ends (potentially truncated) | 88.46 % |
% of genes from short scaffolds (< 2000 bps) | 74.62 % |
Associated GOLD sequencing projects | 54 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.308 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (44.615 % of family members) |
Environment Ontology (ENVO) | Unclassified (73.846 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) (50.769 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF01208 | URO-D | 5.38 |
PF00465 | Fe-ADH | 2.31 |
PF09335 | SNARE_assoc | 2.31 |
PF12146 | Hydrolase_4 | 2.31 |
PF00106 | adh_short | 2.31 |
PF00694 | Aconitase_C | 2.31 |
PF01642 | MM_CoA_mutase | 1.54 |
PF00582 | Usp | 1.54 |
PF00005 | ABC_tran | 1.54 |
PF02574 | S-methyl_trans | 1.54 |
PF08241 | Methyltransf_11 | 1.54 |
PF00011 | HSP20 | 1.54 |
PF02585 | PIG-L | 1.54 |
PF07992 | Pyr_redox_2 | 1.54 |
PF02954 | HTH_8 | 1.54 |
PF01467 | CTP_transf_like | 1.54 |
PF00753 | Lactamase_B | 1.54 |
PF07690 | MFS_1 | 1.54 |
PF04358 | DsrC | 1.54 |
PF02036 | SCP2 | 1.54 |
PF00248 | Aldo_ket_red | 1.54 |
PF13561 | adh_short_C2 | 0.77 |
PF11219 | DUF3014 | 0.77 |
PF00682 | HMGL-like | 0.77 |
PF01315 | Ald_Xan_dh_C | 0.77 |
PF06808 | DctM | 0.77 |
PF00436 | SSB | 0.77 |
PF02803 | Thiolase_C | 0.77 |
PF03972 | MmgE_PrpD | 0.77 |
PF02577 | BFN_dom | 0.77 |
PF02361 | CbiQ | 0.77 |
PF04199 | Cyclase | 0.77 |
PF06325 | PrmA | 0.77 |
PF04055 | Radical_SAM | 0.77 |
PF05226 | CHASE2 | 0.77 |
PF05015 | HigB-like_toxin | 0.77 |
PF11249 | DUF3047 | 0.77 |
PF04280 | Tim44 | 0.77 |
PF00378 | ECH_1 | 0.77 |
PF12706 | Lactamase_B_2 | 0.77 |
PF11136 | DUF2889 | 0.77 |
PF02915 | Rubrerythrin | 0.77 |
PF00411 | Ribosomal_S11 | 0.77 |
PF01568 | Molydop_binding | 0.77 |
PF07963 | N_methyl | 0.77 |
PF07977 | FabA | 0.77 |
PF04011 | LemA | 0.77 |
PF13458 | Peripla_BP_6 | 0.77 |
PF12694 | cpYpsA | 0.77 |
PF16576 | HlyD_D23 | 0.77 |
PF06414 | Zeta_toxin | 0.77 |
PF08442 | ATP-grasp_2 | 0.77 |
PF01980 | TrmO | 0.77 |
PF04290 | DctQ | 0.77 |
PF13401 | AAA_22 | 0.77 |
PF13344 | Hydrolase_6 | 0.77 |
PF01512 | Complex1_51K | 0.77 |
PF01808 | AICARFT_IMPCHas | 0.77 |
PF13187 | Fer4_9 | 0.77 |
PF02700 | PurS | 0.77 |
PF13181 | TPR_8 | 0.77 |
PF13511 | DUF4124 | 0.77 |
PF02687 | FtsX | 0.77 |
PF04073 | tRNA_edit | 0.77 |
PF13557 | Phenol_MetA_deg | 0.77 |
PF00884 | Sulfatase | 0.77 |
PF02589 | LUD_dom | 0.77 |
PF00795 | CN_hydrolase | 0.77 |
PF05524 | PEP-utilisers_N | 0.77 |
PF00892 | EamA | 0.77 |
PF13207 | AAA_17 | 0.77 |
PF08340 | DUF1732 | 0.77 |
PF00589 | Phage_integrase | 0.77 |
PF04015 | DUF362 | 0.77 |
PF01613 | Flavin_Reduct | 0.77 |
PF13932 | GIDA_C | 0.77 |
PF00702 | Hydrolase | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 5.38 |
COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 2.31 |
COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 2.31 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 2.31 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 2.31 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 2.31 |
COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 2.31 |
COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 2.31 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.54 |
COG0458 | Carbamoylphosphate synthase large subunit | Amino acid transport and metabolism [E] | 1.54 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 1.54 |
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 1.54 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 1.54 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.54 |
COG2920 | Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C) | Translation, ribosomal structure and biogenesis [J] | 1.54 |
COG0026 | Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) | Nucleotide transport and metabolism [F] | 0.77 |
COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 0.77 |
COG0100 | Ribosomal protein S11 | Translation, ribosomal structure and biogenesis [J] | 0.77 |
COG0138 | AICAR transformylase/IMP cyclohydrolase PurH | Nucleotide transport and metabolism [F] | 0.77 |
COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.77 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.77 |
COG0619 | ECF-type transporter transmembrane protein EcfT | Coenzyme transport and metabolism [H] | 0.77 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.77 |
COG0764 | 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase | Lipid transport and metabolism [I] | 0.77 |
COG1042 | Acyl-CoA synthetase (NDP forming) | Energy production and conversion [C] | 0.77 |
COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.77 |
COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.77 |
COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.77 |
COG1828 | Phosphoribosylformylglycinamidine (FGAM) synthase, PurS subunit | Nucleotide transport and metabolism [F] | 0.77 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.77 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.77 |
COG1894 | NADH:ubiquinone oxidoreductase, NADH-binding 51 kD subunit (chain F) | Energy production and conversion [C] | 0.77 |
COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.77 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.77 |
COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.77 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.77 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.77 |
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.77 |
COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.77 |
COG4395 | Predicted lipid-binding transport protein, Tim44 family | Lipid transport and metabolism [I] | 0.77 |
COG4656 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfC subunit | Energy production and conversion [C] | 0.77 |
COG4706 | Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain | Lipid transport and metabolism [I] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.31 % |
Unclassified | root | N/A | 17.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000231|TB_LI09_4DRAFT_10066173 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
3300000231|TB_LI09_4DRAFT_10213827 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300003861|Ga0031654_10256490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halarsenatibacter → Halarsenatibacter silvermanii | 506 | Open in IMG/M |
3300004481|Ga0069718_10050743 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
3300004481|Ga0069718_10066679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 527 | Open in IMG/M |
3300004481|Ga0069718_16323468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aerophobetes → Candidatus Aerophobus | 1623 | Open in IMG/M |
3300006224|Ga0079037_100687335 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300006224|Ga0079037_102352673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300006930|Ga0079303_10060174 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300009009|Ga0105105_10302574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 864 | Open in IMG/M |
3300009037|Ga0105093_10249956 | Not Available | 928 | Open in IMG/M |
3300009037|Ga0105093_10900872 | Not Available | 520 | Open in IMG/M |
3300009078|Ga0105106_10004877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 9596 | Open in IMG/M |
3300009078|Ga0105106_10052340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3016 | Open in IMG/M |
3300009078|Ga0105106_10092865 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
3300009078|Ga0105106_10109597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2031 | Open in IMG/M |
3300009078|Ga0105106_10469026 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300009078|Ga0105106_10937405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 616 | Open in IMG/M |
3300009078|Ga0105106_11021615 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300009081|Ga0105098_10352988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 719 | Open in IMG/M |
3300009082|Ga0105099_10136265 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
3300009082|Ga0105099_10160135 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
3300009082|Ga0105099_10574902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 689 | Open in IMG/M |
3300009085|Ga0105103_10032325 | All Organisms → cellular organisms → Bacteria | 2606 | Open in IMG/M |
3300009085|Ga0105103_10080464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1675 | Open in IMG/M |
3300009085|Ga0105103_10107176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
3300009085|Ga0105103_10169191 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300009085|Ga0105103_10713696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 577 | Open in IMG/M |
3300009085|Ga0105103_10714084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
3300009087|Ga0105107_10010021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6524 | Open in IMG/M |
3300009087|Ga0105107_10013948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 5589 | Open in IMG/M |
3300009087|Ga0105107_10263512 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales | 1203 | Open in IMG/M |
3300009087|Ga0105107_10859142 | Not Available | 631 | Open in IMG/M |
3300009091|Ga0102851_10563776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1183 | Open in IMG/M |
3300009111|Ga0115026_10085129 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
3300009111|Ga0115026_10282334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1153 | Open in IMG/M |
3300009111|Ga0115026_10359398 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300009111|Ga0115026_10390658 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300009131|Ga0115027_11898753 | Not Available | 502 | Open in IMG/M |
3300009146|Ga0105091_10040986 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
3300009146|Ga0105091_10422208 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300009146|Ga0105091_10613412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 563 | Open in IMG/M |
3300009146|Ga0105091_10723862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 523 | Open in IMG/M |
3300009165|Ga0105102_10179539 | Not Available | 1048 | Open in IMG/M |
3300009165|Ga0105102_10386858 | Not Available | 741 | Open in IMG/M |
3300009166|Ga0105100_10035869 | All Organisms → cellular organisms → Bacteria | 2878 | Open in IMG/M |
3300009166|Ga0105100_10633909 | Not Available | 656 | Open in IMG/M |
3300009166|Ga0105100_10906403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
3300009167|Ga0113563_10114787 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
3300009167|Ga0113563_10389150 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
3300009169|Ga0105097_10075073 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
3300009169|Ga0105097_10096318 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
3300009171|Ga0105101_10347360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 719 | Open in IMG/M |
3300009171|Ga0105101_10496052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
3300009171|Ga0105101_10618121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 539 | Open in IMG/M |
3300009179|Ga0115028_10378227 | Not Available | 985 | Open in IMG/M |
3300014256|Ga0075318_1106903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
3300018070|Ga0184631_10225446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 772 | Open in IMG/M |
3300027675|Ga0209077_1196769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 562 | Open in IMG/M |
3300027675|Ga0209077_1227572 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300027721|Ga0209492_1040291 | Not Available | 1640 | Open in IMG/M |
3300027721|Ga0209492_1068213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus | 1255 | Open in IMG/M |
3300027721|Ga0209492_1188609 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300027723|Ga0209703_1050732 | Not Available | 1614 | Open in IMG/M |
3300027723|Ga0209703_1295077 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobium/Pelodictyon group → Chlorobium → Chlorobium limicola | 576 | Open in IMG/M |
3300027726|Ga0209285_10187543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 645 | Open in IMG/M |
3300027726|Ga0209285_10229061 | Not Available | 583 | Open in IMG/M |
3300027818|Ga0209706_10008126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5445 | Open in IMG/M |
3300027818|Ga0209706_10062954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1863 | Open in IMG/M |
3300027818|Ga0209706_10357784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermosediminibacterales → Tepidanaerobacteraceae → Tepidanaerobacter → Tepidanaerobacter acetatoxydans → Tepidanaerobacter acetatoxydans Re1 | 684 | Open in IMG/M |
3300027818|Ga0209706_10523073 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300027877|Ga0209293_10366491 | Not Available | 742 | Open in IMG/M |
3300027897|Ga0209254_10308324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1208 | Open in IMG/M |
3300027900|Ga0209253_10139962 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
3300027902|Ga0209048_10058190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3117 | Open in IMG/M |
3300027902|Ga0209048_10113842 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
3300027902|Ga0209048_10197759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1465 | Open in IMG/M |
3300027902|Ga0209048_10414364 | Not Available | 922 | Open in IMG/M |
3300027972|Ga0209079_10008271 | All Organisms → cellular organisms → Bacteria | 3503 | Open in IMG/M |
3300027972|Ga0209079_10018554 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
3300027972|Ga0209079_10034572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1694 | Open in IMG/M |
3300027972|Ga0209079_10213202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 660 | Open in IMG/M |
3300027972|Ga0209079_10329495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 516 | Open in IMG/M |
3300027979|Ga0209705_10356144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 735 | Open in IMG/M |
3300031707|Ga0315291_10145225 | All Organisms → cellular organisms → Bacteria | 2489 | Open in IMG/M |
3300031707|Ga0315291_10412538 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300031746|Ga0315293_10425069 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300031746|Ga0315293_10705390 | Not Available | 750 | Open in IMG/M |
3300031772|Ga0315288_10009088 | All Organisms → cellular organisms → Bacteria | 12533 | Open in IMG/M |
3300031772|Ga0315288_10570344 | Not Available | 1099 | Open in IMG/M |
3300031834|Ga0315290_10009661 | All Organisms → cellular organisms → Bacteria | 7168 | Open in IMG/M |
3300031873|Ga0315297_10107776 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
3300031885|Ga0315285_10006856 | All Organisms → cellular organisms → Bacteria | 11744 | Open in IMG/M |
3300031885|Ga0315285_10011441 | All Organisms → cellular organisms → Bacteria | 9049 | Open in IMG/M |
3300031885|Ga0315285_10086235 | All Organisms → cellular organisms → Bacteria | 2786 | Open in IMG/M |
3300031997|Ga0315278_10027455 | All Organisms → cellular organisms → Bacteria | 5451 | Open in IMG/M |
3300031997|Ga0315278_10041919 | All Organisms → cellular organisms → Bacteria | 4458 | Open in IMG/M |
3300031997|Ga0315278_10130975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2552 | Open in IMG/M |
3300031997|Ga0315278_10133655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2525 | Open in IMG/M |
3300031999|Ga0315274_10053658 | All Organisms → cellular organisms → Bacteria | 5415 | Open in IMG/M |
3300032046|Ga0315289_10444357 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300032046|Ga0315289_10823108 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300032053|Ga0315284_10662658 | Not Available | 1233 | Open in IMG/M |
3300032069|Ga0315282_10559554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 630 | Open in IMG/M |
3300032070|Ga0315279_10459935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 850 | Open in IMG/M |
3300032143|Ga0315292_10113074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile → Desulfomonile tiedjei | 2137 | Open in IMG/M |
3300032156|Ga0315295_10060212 | All Organisms → cellular organisms → Bacteria | 3592 | Open in IMG/M |
3300032164|Ga0315283_10642843 | Not Available | 1146 | Open in IMG/M |
3300032177|Ga0315276_10540690 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300032342|Ga0315286_10041979 | All Organisms → cellular organisms → Bacteria | 4805 | Open in IMG/M |
3300032342|Ga0315286_11173091 | Not Available | 753 | Open in IMG/M |
3300032401|Ga0315275_10596432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1234 | Open in IMG/M |
3300032516|Ga0315273_10533648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1566 | Open in IMG/M |
3300032516|Ga0315273_10759988 | Not Available | 1267 | Open in IMG/M |
3300033406|Ga0316604_10093494 | Not Available | 1575 | Open in IMG/M |
3300033414|Ga0316619_10592529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 920 | Open in IMG/M |
3300033419|Ga0316601_100414930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1271 | Open in IMG/M |
3300033433|Ga0326726_10403467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1297 | Open in IMG/M |
3300033434|Ga0316613_10205868 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300033434|Ga0316613_10280570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1097 | Open in IMG/M |
3300033434|Ga0316613_10584018 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300033487|Ga0316630_10392674 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1104 | Open in IMG/M |
3300033488|Ga0316621_10546947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → unclassified Syntrophomonadaceae → Syntrophomonadaceae bacterium | 816 | Open in IMG/M |
3300033488|Ga0316621_11044792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 611 | Open in IMG/M |
3300033513|Ga0316628_100810347 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300033513|Ga0316628_101598475 | Not Available | 868 | Open in IMG/M |
3300033521|Ga0316616_102468609 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300033557|Ga0316617_100381761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1234 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 44.62% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 23.08% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.00% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 6.15% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 5.38% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.85% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.31% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 1.54% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.77% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.77% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.77% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300014256 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2 | Environmental | Open in IMG/M |
3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB_LI09_4DRAFT_100661734 | 3300000231 | Groundwater | MSAERWFRKKLQMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYETISK* |
TB_LI09_4DRAFT_102138271 | 3300000231 | Groundwater | ERWFRKKLQMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETINTDSGVCA* |
Ga0031654_102395671 | 3300003861 | Freshwater Lake Sediment | WFRKKLQMQGAQKLRSEAYLQVRCNDEVEAQRSRWTFYETIKICAPHFVKPSVIG* |
Ga0031654_102564901 | 3300003861 | Freshwater Lake Sediment | XWXRKKLQMQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETITLMGVKIA* |
Ga0069718_100507432 | 3300004481 | Sediment | SREGWFRKKLQMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETITDN* |
Ga0069718_100666792 | 3300004481 | Sediment | FRKKLQMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETINIRHFENL* |
Ga0069718_163234682 | 3300004481 | Sediment | VKNFAKGWLRKKLQMQGAQKLRSEAHLRVHRNDEVEAQRRRWTFYEAISF* |
Ga0079037_1006873351 | 3300006224 | Freshwater Wetlands | RKKLQMQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFCETSKSVKT* |
Ga0079037_1023526731 | 3300006224 | Freshwater Wetlands | WFRKKLQMQGAQKLRREAHEQVRRNDEVAAQRRRWTFYETINYSPKDSPTR* |
Ga0079303_100601742 | 3300006930 | Deep Subsurface | MPGKRWFYQKVQMQGAQKIIIGAIHELPLRVRRNDEVAAQSRSERDR* |
Ga0105105_103025741 | 3300009009 | Freshwater Sediment | KRWFRKKLQMPGAQKLRNEVHSRVRRRWIFYETIKIT* |
Ga0105093_102499561 | 3300009037 | Freshwater Sediment | MGGFSGKICERWFCKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRSWTF |
Ga0105093_109008721 | 3300009037 | Freshwater Sediment | KKLQMQGAQKLRSEAHLQVRRKDEVDAQRRRWTFYETINDDPIKSL* |
Ga0105106_1000487716 | 3300009078 | Freshwater Sediment | SARKKSEKRWFRKKLQMQGAQKLRSGAHLLVRRNDEVAAQRRRWTFYEAIVY* |
Ga0105106_100523403 | 3300009078 | Freshwater Sediment | MGGFSGKICERWFCKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRSWTFYETIK* |
Ga0105106_100928651 | 3300009078 | Freshwater Sediment | ERWFRKKLQMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIRLNKHE* |
Ga0105106_101095971 | 3300009078 | Freshwater Sediment | ERWFRKKLQMQGAQKLRSEAHSQVRCNDEVEAQRRRWTFYETIN* |
Ga0105106_104690262 | 3300009078 | Freshwater Sediment | MPEPWFRKTLQMPGAQKLRREAHFRVRRNDEVAAQCRRWTFYETIKEGRLDV* |
Ga0105106_109374051 | 3300009078 | Freshwater Sediment | RWLCKKLQMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYEAIKLFYRPF* |
Ga0105106_110216151 | 3300009078 | Freshwater Sediment | RWFRKKLQMPGAQKLRSAAYLLVRCNDEVEAQRRRWTFYETIKLHRNFSAKW* |
Ga0105098_103529881 | 3300009081 | Freshwater Sediment | RWFRKKLQMQGAQKLRNEAHLRMRRNDKVAAQRRRWTFYETIRFHG* |
Ga0105099_101362652 | 3300009082 | Freshwater Sediment | MGGFSGKICERWFCKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRSWTFYETIN* |
Ga0105099_101601352 | 3300009082 | Freshwater Sediment | RKKLQMQGAQKLRSEAHLRVHRNDEVEAQRRRWTFYEAISF* |
Ga0105099_105749021 | 3300009082 | Freshwater Sediment | KLQMQGAQKIIIVGAIHESPLRVRCNDEVEAQRRRWTFYEPIKNIYFLSA* |
Ga0105103_100323252 | 3300009085 | Freshwater Sediment | VKNFAKGWLRKKLQMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEAISF* |
Ga0105103_100804644 | 3300009085 | Freshwater Sediment | CKKLQMPGAQKLRSEAYEQVRCNDEVEVQRRRWTFCETIIFLDLFFRR* |
Ga0105103_101071765 | 3300009085 | Freshwater Sediment | WFCKKLQMPGAQKLRSEEHLQVPRNDKVEAQRRGWTFYETIKKS* |
Ga0105103_101691913 | 3300009085 | Freshwater Sediment | SAERWLCKKLQMQGAQKPRSEAHLQVRRNDEVAAQRRRWTFYEAIKIAPGSRFE* |
Ga0105103_103409701 | 3300009085 | Freshwater Sediment | PRRWFRKKLQMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIMIHCPHRENR* |
Ga0105103_107136962 | 3300009085 | Freshwater Sediment | PKRWFRKKLQMPGAQKLRSEAYLTVRRNDEVEAQRRRWTFYETIKF* |
Ga0105103_107140842 | 3300009085 | Freshwater Sediment | WFRKKLQMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETIKF* |
Ga0105107_1001002110 | 3300009087 | Freshwater Sediment | KKLQMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYEAIKLFYRPF* |
Ga0105107_100139488 | 3300009087 | Freshwater Sediment | MSSKRWFRKKLQMQGAQKLRSEAHLRVRRNDEVEAQRHRWTFYETIKFPAEKRG |
Ga0105107_102635123 | 3300009087 | Freshwater Sediment | FRKKLQMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKNR* |
Ga0105107_108591422 | 3300009087 | Freshwater Sediment | KKSPKRWFRKKLQMQGAQKLRSEAHFQVRRNDKVAAQRRRWTFYETIIFV* |
Ga0102851_105637761 | 3300009091 | Freshwater Wetlands | MNSLKSLKRWFRKKLQMQGAQKLRSEAHLQVCRNDEVEAQSRSERDRWTFYET |
Ga0115026_100851291 | 3300009111 | Wetland | KRWFRKKLQMQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFCETSKSVKI* |
Ga0115026_102823342 | 3300009111 | Wetland | RKKLQMQGAQKLRSEAHLQLRRNDEVAAQSRSERDRWTFYETIKTG* |
Ga0115026_103593981 | 3300009111 | Wetland | RWFRKKLQVQGAQKLRSEAHLWVRRNDEVAAQRSRWTFYETIKF* |
Ga0115026_103906581 | 3300009111 | Wetland | KRGERWFRKKLQMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIF* |
Ga0115027_118987532 | 3300009131 | Wetland | KRWFRKKLQMQGAQKPRSEAHLQVRRNDEVAAQSRSERDRWTFCKTIIL* |
Ga0105091_100409862 | 3300009146 | Freshwater Sediment | VKNFAKGWLRKKLQMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEAISL* |
Ga0105091_104222083 | 3300009146 | Freshwater Sediment | MPEPWFRKTLQMPGAQKLRREAHFRMRRNDEVAAQCRRWTFYETIKEGRLDV* |
Ga0105091_106134121 | 3300009146 | Freshwater Sediment | KKSPERWFCKKLQMPGAQKLRSEEHLQVPRNDKVEAQRRGWTFYETIKKS* |
Ga0105091_107238621 | 3300009146 | Freshwater Sediment | RFRKKLQMQGAQKLRSEAHKQVRRNDEVAVQSCSERGRWTFFKTVLIK* |
Ga0105102_101795391 | 3300009165 | Freshwater Sediment | MGGFSGKICERWFCKKLQMQCAQKLRSEAHLRVRRNDEVAAQRRSWTFYETIK* |
Ga0105102_103868581 | 3300009165 | Freshwater Sediment | RKKLQMQGAQKLRSEAYEQVRCNDEVEAQRRRWTFYEAITLAPFFAR* |
Ga0105100_100358691 | 3300009166 | Freshwater Sediment | RWFRKKLQMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETINI* |
Ga0105100_106339092 | 3300009166 | Freshwater Sediment | RKKLQMQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETIKYHRA* |
Ga0105100_109064031 | 3300009166 | Freshwater Sediment | VKNFAKGWLRKKLQMQGAQKLRSEAHLRVHRNDEVEAQRRRWTFYEAIS |
Ga0113563_101147873 | 3300009167 | Freshwater Wetlands | KKLQMQGAQKLRSEAHLQVRRNDEVAAQSPSERDRWTFCETSKSVKI* |
Ga0113563_103891501 | 3300009167 | Freshwater Wetlands | RWFRKKLQMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIF* |
Ga0105097_100750731 | 3300009169 | Freshwater Sediment | RWFRKKLQMQGAQKLRREAHLRVRRNDEVEAQRRRWTFYETIKFAEY* |
Ga0105097_100963183 | 3300009169 | Freshwater Sediment | GKICERWFCKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRSWTFYETIK* |
Ga0105101_103473602 | 3300009171 | Freshwater Sediment | RKKLQMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETITLQFFEKGAS* |
Ga0105101_104960522 | 3300009171 | Freshwater Sediment | GWFRKKLQMQGAQKPRSEAHILVRRNDEVEAQRRRWTFYETITGSAWR* |
Ga0105101_106181212 | 3300009171 | Freshwater Sediment | WFRKKLQMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIMIHCPHRENR* |
Ga0115028_103782271 | 3300009179 | Wetland | RKKLQMQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITILFLKK* |
Ga0075318_11069032 | 3300014256 | Natural And Restored Wetlands | RKKSAKRWFRKKLQMPGAQKLRSEAHLRVRRSDEVEAQRRRWTFYETIK* |
Ga0184631_102254461 | 3300018070 | Groundwater Sediment | MQGAQKLRNEAYLWVRCNDEGEAQRRRWTFYEAIKSRVLQEGFHLKNI |
Ga0209077_11967691 | 3300027675 | Freshwater Sediment | KKSPERWFCKKLQMPGAQKLRSEEHLQVPRNDKVEAQRRGWTFYETIKKS |
Ga0209077_12275722 | 3300027675 | Freshwater Sediment | MPEPWFRKTLQMPGAQKLRREAHFRMRRNDEVAAQCRRWTFYETIKEGRLDV |
Ga0209492_10402912 | 3300027721 | Freshwater Sediment | WFRKKLQMQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETIKYHRA |
Ga0209492_10682133 | 3300027721 | Freshwater Sediment | KKLQMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETIKPTGTGF |
Ga0209492_11886092 | 3300027721 | Freshwater Sediment | WLCKKLQMQGAQKLRSEAHLLVRRNDEVEAQRRRWTFYEAIKFRKGEKNIWR |
Ga0209703_10507322 | 3300027723 | Freshwater Sediment | KKSAEGWFRKKLQMQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETIKYHRA |
Ga0209703_12950772 | 3300027723 | Freshwater Sediment | WFRKKLQMQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETINPC |
Ga0209285_101875431 | 3300027726 | Freshwater Sediment | FRKKLQMQGAQKLRSEAHKQVRRNDEVAVQSCSERGRWTFYKTVLIK |
Ga0209285_102290611 | 3300027726 | Freshwater Sediment | MTSKKSGDRWFGKKLQMQGAQKLRSEGHLQVRRNDEVEAQRRRWTFSETIE |
Ga0209706_100081262 | 3300027818 | Freshwater Sediment | MGGFSGKICERWFCKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRSWTFYETIK |
Ga0209706_100629541 | 3300027818 | Freshwater Sediment | VKNFAKGWLRKKLQMQGAQKLRSEAHLRVHRNDEVEAQRRRWTFYE |
Ga0209706_103577842 | 3300027818 | Freshwater Sediment | RWFRKKLQMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETIKPTGTGF |
Ga0209706_105230731 | 3300027818 | Freshwater Sediment | KKLAERWFRKKLQMQGAQKLRSEAHFQVRRNDKVAAQRRRWTFYETIIFV |
Ga0209293_103664913 | 3300027877 | Wetland | KRGERWFRKKLQMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIF |
Ga0209254_103083241 | 3300027897 | Freshwater Lake Sediment | WFRKKLQMPGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETINFRHF |
Ga0209253_101399623 | 3300027900 | Freshwater Lake Sediment | RWFRKKLQMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETIKFC |
Ga0209048_100581901 | 3300027902 | Freshwater Lake Sediment | KSPERWFRKKLQMQGAQKLRSEAYLQVRCNDEGEAQRRRWTFYETISTEFYP |
Ga0209048_101138421 | 3300027902 | Freshwater Lake Sediment | KVAERWFRKKLQMQGAQKLRSEAYLQVRCNDEGEAQRSRWTFYETITFG |
Ga0209048_101977592 | 3300027902 | Freshwater Lake Sediment | RKKSPERWLRKKLQMQGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIIP |
Ga0209048_104143641 | 3300027902 | Freshwater Lake Sediment | FRKKLQMQGAQKLRSEAYLQVRCNDEVEAQRSRWTFYETINNR |
Ga0209079_100082712 | 3300027972 | Freshwater Sediment | MPEPWFRKTLQMPGAQKLRREAHFRVRRNDEVAAQCRRWTFYETIKEGRLDV |
Ga0209079_100185541 | 3300027972 | Freshwater Sediment | FHKKLQMPGAQKLRRAAHYQVRRNDEVEAQRRRWTFYETIKFACA |
Ga0209079_100345723 | 3300027972 | Freshwater Sediment | KKYAERWFCKKLQMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETICMNRRETGRGRR |
Ga0209079_102132021 | 3300027972 | Freshwater Sediment | AERWLCKKLQMQGAQKPRSEAHLQVRRNDEVAAQRRRWTFYEAIKIAPGSRFE |
Ga0209079_103294952 | 3300027972 | Freshwater Sediment | TKRWFRKKLQMPGAQKLRSEAYLTVRRNDEVEAQRRRWTFYETIKF |
Ga0209705_103561442 | 3300027979 | Freshwater Sediment | ERWFRKKLQMQGAQKLRSEAHSQVRCNDEVEAQRRRWTFYETIN |
Ga0315291_101452251 | 3300031707 | Sediment | WFRKKLQMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETISN |
Ga0315291_104125382 | 3300031707 | Sediment | AERWFRKKLQMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINVGMVEYWEN |
Ga0315293_104250692 | 3300031746 | Sediment | AERWFRKKLQLQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIKICLSNWEEA |
Ga0315293_107053902 | 3300031746 | Sediment | WFRKKIQMPGAQKLRSEAHLQVRCNDEVEAQRRRWTFYETINFVTFIFSGR |
Ga0315288_1000908815 | 3300031772 | Sediment | MQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYDFINVGMVEYWEN |
Ga0315288_105703442 | 3300031772 | Sediment | WFCKKLQMPGAQKLRSEAHLHVRRNDEVEAQRRRWTFYETFTFRPL |
Ga0315290_100096611 | 3300031834 | Sediment | FRKKLQLQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIKICLSNWEEA |
Ga0315297_101077763 | 3300031873 | Sediment | GRFRKKLQMQGAQKLRREAYLHVRCNDEVEAQRSRWTFYDFINVGMVEYWEN |
Ga0315285_100068561 | 3300031885 | Sediment | RWFRKKLQLQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIKICLSNWEEA |
Ga0315285_100114416 | 3300031885 | Sediment | MQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINVGMVEYWEN |
Ga0315285_100862351 | 3300031885 | Sediment | RWFRKKLQMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETISN |
Ga0315278_100274556 | 3300031997 | Sediment | KKLQMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYDFINVGMVEYWEN |
Ga0315278_100419191 | 3300031997 | Sediment | WLRKKLQMQGAQKLRSEAHLRVRRSDEVAAQRRRWTFYEAIKKGGWQ |
Ga0315278_101309752 | 3300031997 | Sediment | KSPERWFRKKLQMQGAQKLRSEAHLQVRRSDEVEAQRSRWTFYETIKFKDSEH |
Ga0315278_101336551 | 3300031997 | Sediment | WLRKKLQMQGAQKLRSETHLRVRRNDEVEAQRRRWTFYEAINLGRKIWRD |
Ga0315274_100536587 | 3300031999 | Sediment | RWFRKKLQMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINLDEIVKSP |
Ga0315289_104443571 | 3300032046 | Sediment | WFRKKLQMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYDFINVGMVEYWEN |
Ga0315289_108231081 | 3300032046 | Sediment | RALKLQLQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIKICLSNWEEA |
Ga0315284_106626582 | 3300032053 | Sediment | KRWFRKKLQMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIRKGRQTTR |
Ga0315282_105595541 | 3300032069 | Sediment | KKLQMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINIELGPYHIP |
Ga0315279_104599352 | 3300032070 | Sediment | FRKKLQMQGAQKLRSEAYLDVRCNDEVEAQRRRWTFYETITLNLL |
Ga0315292_101130741 | 3300032143 | Sediment | FRKKLQLQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETITYECFAS |
Ga0315295_100602121 | 3300032156 | Sediment | KKLRSAAHLHVRRNDEVEAQSRSERDRWTFYETFTLRPL |
Ga0315283_106428431 | 3300032164 | Sediment | RKKLQMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIRKGRQTTR |
Ga0315276_105406902 | 3300032177 | Sediment | RKKFQMPGAQKLRSEAHFKMHPNDEVAGQRRRWTFYETINIAISSTSNQE |
Ga0315286_100419791 | 3300032342 | Sediment | LPERWFRKKLQMQGAQKLRSEVHLRVRRNDEVAAQRRRGTFYETINICNLQ |
Ga0315286_111730911 | 3300032342 | Sediment | RWFRKKLQMQGAQKLRSEAQLQVRRKDEVTAQRRRWTFYETINY |
Ga0315275_105964321 | 3300032401 | Sediment | FRKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKISPFEKGG |
Ga0315273_105336481 | 3300032516 | Sediment | WFRKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKTRFLQYLF |
Ga0315273_107599881 | 3300032516 | Sediment | FRKKLQLQGAQKLRSEAYLHVRCNDEVAAQRSRWTFYETIKITG |
Ga0316604_100934942 | 3300033406 | Soil | RKKSANRWFRKKLQMPGAQKLRSEAHLRVRRNDEVAAQSRSERNRWTFYETINN |
Ga0316619_105925292 | 3300033414 | Soil | FHPELGERWFRKKLRMPGAQKLRSEAHIYVRRSDEVAAQPRSERDRWTFYRTI |
Ga0316601_1004149301 | 3300033419 | Soil | KSAKRWFRKKFHMQGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIKFYYFIHSHLPI |
Ga0326726_104034671 | 3300033433 | Peat Soil | MQGAQNLTREVYLQARRNDEGEVQRSRWTFYETINVEIEIKDKT |
Ga0316613_102058681 | 3300033434 | Soil | WLRKKLQMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEAIK |
Ga0316613_102805701 | 3300033434 | Soil | TRKKSVKRWFRKKLQLQGAQKLRSEARLQVRRNDEVAAHSRSARDRWTF |
Ga0316613_105840183 | 3300033434 | Soil | WFRKKLQMQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFCETSKSVKT |
Ga0316630_103926741 | 3300033487 | Soil | FRKRLQKQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYEPSNILCHAQNA |
Ga0316621_105469471 | 3300033488 | Soil | RKKLQMQGAQKLRSEAHLRVHRSNEVEAQRRRWTFCETIIIPWP |
Ga0316621_110447921 | 3300033488 | Soil | KDDLTKKFPVRWFCKKRQMQGAQKLRSEAYFQVCRNEEAEAQRRRWKFYEAVKKS |
Ga0316628_1008103472 | 3300033513 | Soil | RWFRKKLQMQGAQKLRSEAHFRVRRNDEVEAQRRRWTFYETLKE |
Ga0316628_1015984752 | 3300033513 | Soil | AKRWFRKKLQTQGAQKLRSEAHEHVRCNDEVEAQHSRWIFYETIKLPFQ |
Ga0316616_1024686091 | 3300033521 | Soil | WFRKKLQMQGAQKLRSEAHLQVRRNDEVAAQSPSERDRWTFCETSKSVKI |
Ga0316617_1003817611 | 3300033557 | Soil | LRKKLQMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEVIIIINF |
⦗Top⦘ |