NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064047

Metagenome / Metatranscriptome Family F064047

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064047
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 42 residues
Representative Sequence MTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAA
Number of Associated Samples 129
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 87.60 %
% of genes from short scaffolds (< 2000 bps) 79.07 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.915 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil
(8.527 % of family members)
Environment Ontology (ENVO) Unclassified
(16.279 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.713 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 44.93%    β-sheet: 0.00%    Coil/Unstructured: 55.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF00543P-II 82.95
PF00909Ammonium_transp 12.40
PF01494FAD_binding_3 1.55
PF136224HBT_3 0.78
PF04073tRNA_edit 0.78
PF13410GST_C_2 0.78
PF03969AFG1_ATPase 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0347Nitrogen regulatory protein PIISignal transduction mechanisms [T] 82.95
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 12.40
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 3.10
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.55
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 1.55
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 1.55
COG1485Cell division protein ZapE (Z ring-associated ATPase), AFG1 superfamilyCell cycle control, cell division, chromosome partitioning [D] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.91 %
All OrganismsrootAll Organisms41.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908029|A2_v1_NODE_19396_len_3897_cov_12_346420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3947Open in IMG/M
2124908036|A5_v_NODE_2361_len_924_cov_14_082252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.974Open in IMG/M
2124908037|B3_GZBA_v_NODE_14236_len_858_cov_12_911422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.908Open in IMG/M
2124908039|B3_v_NODE_456_len_1964_cov_39_250000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.2014Open in IMG/M
2124908043|A2_c1_ConsensusfromContig64760Not Available776Open in IMG/M
3300000156|NODE_c0685464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris3221Open in IMG/M
3300000313|WSSedB1CaDRAFT_10080723Not Available614Open in IMG/M
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1025586Not Available645Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10052856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1052Open in IMG/M
3300000701|JGI12340J11893_101646Not Available687Open in IMG/M
3300000729|JGI12371J11900_1013890Not Available538Open in IMG/M
3300000905|JGI12406J12870_105721Not Available525Open in IMG/M
3300000909|JGI12488J12863_103829Not Available804Open in IMG/M
3300000935|JGI12407J12866_104688Not Available689Open in IMG/M
3300000953|JGI11615J12901_10018931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843514Open in IMG/M
3300000956|JGI10216J12902_113356538Not Available616Open in IMG/M
3300001398|JGI20207J14881_1007851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3122Open in IMG/M
3300001406|JGI20187J14854_1005918Not Available671Open in IMG/M
3300001593|JGI12635J15846_10315708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales971Open in IMG/M
3300001870|JGI24129J20441_1016888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2077Open in IMG/M
3300001915|JGI24741J21665_1034368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843754Open in IMG/M
3300001978|JGI24747J21853_1003949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1305Open in IMG/M
3300002073|JGI24745J21846_1017253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843839Open in IMG/M
3300002183|JGI24145J26757_10075375Not Available757Open in IMG/M
3300003990|Ga0055455_10037996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1276Open in IMG/M
3300004798|Ga0058859_11434999All Organisms → cellular organisms → Bacteria → Proteobacteria608Open in IMG/M
3300005164|Ga0066815_10022665Not Available889Open in IMG/M
3300005169|Ga0066810_10016042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1187Open in IMG/M
3300005205|Ga0068999_10112277Not Available552Open in IMG/M
3300005288|Ga0065714_10284149Not Available718Open in IMG/M
3300005337|Ga0070682_101874618All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300005439|Ga0070711_100968526Not Available729Open in IMG/M
3300005548|Ga0070665_101020193Not Available839Open in IMG/M
3300005836|Ga0074470_11297541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales9876Open in IMG/M
3300005880|Ga0075298_1039324Not Available503Open in IMG/M
3300005947|Ga0066794_10137254Not Available735Open in IMG/M
3300006057|Ga0075026_100475142Not Available716Open in IMG/M
3300006102|Ga0075015_100907504Not Available535Open in IMG/M
3300006172|Ga0075018_10400820Not Available698Open in IMG/M
3300006173|Ga0070716_101826764Not Available504Open in IMG/M
3300006175|Ga0070712_100128709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1916Open in IMG/M
3300006426|Ga0075037_1884876Not Available569Open in IMG/M
3300006806|Ga0079220_11761684Not Available544Open in IMG/M
3300006972|Ga0075518_1053545Not Available807Open in IMG/M
3300009551|Ga0105238_10068044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3562Open in IMG/M
3300009661|Ga0105858_1204511Not Available582Open in IMG/M
3300009684|Ga0114958_10331672Not Available741Open in IMG/M
3300009792|Ga0126374_11678470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843527Open in IMG/M
3300010396|Ga0134126_10015040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14629787Open in IMG/M
3300012096|Ga0137389_11114403Not Available676Open in IMG/M
3300012899|Ga0157299_10237241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843571Open in IMG/M
3300012944|Ga0137410_11879806Not Available530Open in IMG/M
3300012960|Ga0164301_10026100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2709Open in IMG/M
3300012989|Ga0164305_11869824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843544Open in IMG/M
3300013073|Ga0164283_1073706Not Available751Open in IMG/M
3300013104|Ga0157370_10717010Not Available912Open in IMG/M
3300013764|Ga0120111_1138694Not Available560Open in IMG/M
3300014266|Ga0075359_1053304Not Available719Open in IMG/M
3300014321|Ga0075353_1051058Not Available860Open in IMG/M
3300015373|Ga0132257_102811243Not Available634Open in IMG/M
3300017947|Ga0187785_10095419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621183Open in IMG/M
3300018028|Ga0184608_10093802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621246Open in IMG/M
3300018067|Ga0184611_1159125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843801Open in IMG/M
3300020583|Ga0210401_11247288Not Available602Open in IMG/M
3300020714|Ga0214182_1022170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462941Open in IMG/M
3300021403|Ga0210397_11159611Not Available601Open in IMG/M
3300021476|Ga0187846_10100183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1247Open in IMG/M
3300021478|Ga0210402_11623642Not Available573Open in IMG/M
3300021479|Ga0210410_11336011Not Available609Open in IMG/M
3300024222|Ga0247691_1035855Not Available756Open in IMG/M
3300024279|Ga0247692_1029208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.847Open in IMG/M
3300025509|Ga0208848_1097779Not Available593Open in IMG/M
3300025588|Ga0208586_1024775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.1433Open in IMG/M
3300025725|Ga0209638_1169186Not Available686Open in IMG/M
3300025780|Ga0210100_1001677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2224Open in IMG/M
3300025878|Ga0209584_10094929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.1096Open in IMG/M
3300025891|Ga0209585_10125797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462981Open in IMG/M
3300025903|Ga0207680_10316566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621090Open in IMG/M
3300025905|Ga0207685_10090776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621286Open in IMG/M
3300025911|Ga0207654_10421386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462932Open in IMG/M
3300025916|Ga0207663_10435235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621009Open in IMG/M
3300025936|Ga0207670_11225938Not Available635Open in IMG/M
3300025972|Ga0207668_11281438Not Available659Open in IMG/M
3300026066|Ga0208290_1017924Not Available739Open in IMG/M
3300026748|Ga0207575_101881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843658Open in IMG/M
3300026757|Ga0207605_100898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843718Open in IMG/M
3300026782|Ga0207595_102069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843695Open in IMG/M
3300026828|Ga0207502_100213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621790Open in IMG/M
3300026849|Ga0207804_123180Not Available543Open in IMG/M
3300026870|Ga0208762_1001418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843838Open in IMG/M
3300027000|Ga0207803_1044991Not Available503Open in IMG/M
3300027552|Ga0209982_1020307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621020Open in IMG/M
3300027725|Ga0209178_1006916Not Available3577Open in IMG/M
3300028787|Ga0307323_10003465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14625108Open in IMG/M
3300028800|Ga0265338_11103723Not Available534Open in IMG/M
3300028819|Ga0307296_10709117Not Available549Open in IMG/M
3300028828|Ga0307312_11104760Not Available524Open in IMG/M
3300031562|Ga0310886_10432423Not Available782Open in IMG/M
3300031724|Ga0318500_10529376Not Available594Open in IMG/M
3300031726|Ga0302321_103585048Not Available505Open in IMG/M
3300031740|Ga0307468_100826461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843793Open in IMG/M
3300031765|Ga0318554_10698497Not Available569Open in IMG/M
3300031847|Ga0310907_10382215Not Available729Open in IMG/M
3300031879|Ga0306919_11491082Not Available509Open in IMG/M
3300031910|Ga0306923_10060948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14624187Open in IMG/M
3300031949|Ga0214473_11787720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843608Open in IMG/M
3300031962|Ga0307479_10412054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1336Open in IMG/M
3300032063|Ga0318504_10414952Not Available642Open in IMG/M
3300032177|Ga0315276_11498990Not Available702Open in IMG/M
3300032770|Ga0335085_11016085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.895Open in IMG/M
3300032828|Ga0335080_11924301Not Available574Open in IMG/M
3300032892|Ga0335081_12114697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843596Open in IMG/M
3300033289|Ga0310914_11822630Not Available513Open in IMG/M
3300033475|Ga0310811_11101938Not Available673Open in IMG/M
3300034676|Ga0314801_129729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843592Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil8.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil5.43%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.88%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.33%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.33%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.33%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.55%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.55%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.78%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.78%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.78%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.78%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.78%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.78%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.78%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.78%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.78%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.78%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.78%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908029Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
2124908036Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2124908037Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2124908039Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4EnvironmentalOpen in IMG/M
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2140918006Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1EnvironmentalOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000313Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 CattailEnvironmentalOpen in IMG/M
3300000596Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TCEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000676Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27EnvironmentalOpen in IMG/M
3300000701Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4EnvironmentalOpen in IMG/M
3300000710Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67EnvironmentalOpen in IMG/M
3300000729Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35EnvironmentalOpen in IMG/M
3300000905Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42EnvironmentalOpen in IMG/M
3300000909Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37EnvironmentalOpen in IMG/M
3300000935Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40EnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001398Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012EnvironmentalOpen in IMG/M
3300001406Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001870Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211EnvironmentalOpen in IMG/M
3300001915Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7Host-AssociatedOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300001978Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6Host-AssociatedOpen in IMG/M
3300002073Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4Host-AssociatedOpen in IMG/M
3300002183Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22AEnvironmentalOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005205Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005880Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006426Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006972Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-AEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013073Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 5th pass 37_C Kraft OP (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300014266Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1EnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300020714Freshwater microbial communities from Trout Bog Lake, WI - 14NOV2007 epilimnionEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300023270Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025588Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025725Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025780Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026066Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026748Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026757Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026782Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026818Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026828Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026849Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes)EnvironmentalOpen in IMG/M
3300026870Soil and rhizosphere microbial communities from Laval, Canada - mgLMC (SPAdes)EnvironmentalOpen in IMG/M
3300027000Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes)EnvironmentalOpen in IMG/M
3300027552Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A2_v1_001142402124908029SoilMTLKKPSRAGLLAIASGLLLGLFLSVATYNTSYAQTXXXXXXXX
A5_v_002602602124908036SoilMTLKKSSRAGLTTLALGVLLGLFLSVAAYTTSYAQPAPGAA
B3_GZBA_v_002349602124908037SoilMTLKKPSRAGLVALALGVLLGLFLSVAAYNTSYAQPAPGAAP
B3_v_000638202124908039SoilMTLKKSSRAGLTTLALGVLLGLFLSVAAYTTSYAQPAPGAAPA
A2_c1_009797102124908043SoilMTLKKSSRAGLTTLALGVLLGLFLSVAAYNTSYAQPAPGAAPAAPA
A5_c1_008018602124908044SoilMTLKKSSRAGLTTLALGVLLGLFLSVAAYNTSYAQPAPGAAPAAPAAAAP
P1_C_009939102140918006SoilMTLKKPSRAGLVALALGVLLGLFLSVAAYNTSYAQPAPGAAPAAPAAA
NODE_068546433300000156Sugar Cane Bagasse Incubating BioreactorMTLKKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAAAP
WSSedB1CaDRAFT_1008072313300000313WetlandMTLKKSSRAGLLALAFGILLGLFLSVATYNASYAQ
KanNP_Total_noBrdU_T14TCDRAFT_102558623300000596SoilMTLMKSSRAGLLALAFGILLGLFLSVASYEASYAQAQAPAA
AF_2010_repII_A1DRAFT_1005285633300000597Forest SoilMTLKKSSRAGLMALAFGILLGLFLSVATYDATYAQ
JGI12333J11928_10088513300000676Tropical Forest SoilMTLMKSPRAGRLALAFGVVLSVFLSVAAFDASYAQPAPGAAPAAPAA
JGI12340J11893_10164623300000701Tropical Forest SoilMTLMKSPRAGRLALAFGVVLSVFLSVAAFDASYAQPAPGAAP
JGI12294J11894_10237723300000710Tropical Forest SoilMTLMKSPRAGRLALAFGVVLSVFLSVAAFDASYAQPAPGAAPAAP
JGI12371J11900_101389013300000729Tropical Forest SoilMTLMKSPRAGLLALAFGVVLSLFLSVAAFDASYAQAP
JGI12406J12870_10572123300000905Tropical Forest SoilMTLKKSSRAGLLALAFGVLLGLFLSVASFDASYAQTPAAPAAAPA
JGI12488J12863_10382913300000909Tropical Forest SoilMTLKKSSRAGLLALAFGVLLGLFLSVASFDASYAQTPA
JGI12407J12866_10468823300000935Tropical Forest SoilMTLMKSPGAGLLALAFGVVLSLFLSVGAFDASYAQPAPGAAP
JGI11615J12901_1001893113300000953SoilMTLIKSSRAGLFALAFGILLGLFLSVSPYDISYAQTQAPAAAPAAAPAP
JGI10216J12902_11335653813300000956SoilMTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQA
JGI20207J14881_100785143300001398Arctic Peat SoilMTLMKSSRAGLLTLALGIMLGFFLSVATINSSHAQTPAAPAAAP
JGI20187J14854_100591823300001406Arctic Peat SoilMTLKKPSRAGLVALALGVLLGLFLSVAAYNTSYAQPAPGAAPAAPA
JGI12635J15846_1031570833300001593Forest SoilMTLKKSSRAGLTTLALGVLLGLFLSVAAYTTSYAQPAPGAAPAAPAAA
JGI24129J20441_101688813300001870Arctic Peat SoilMTLKKPSRAGLVALALGVLLGLFLSVAAYNTSYAQPAPGAAPAAPAA
JGI24741J21665_103436813300001915Corn RhizosphereMTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPA
JGI24752J21851_101791133300001976Corn, Switchgrass And Miscanthus RhizosphereMTLMKSSRAGLFALAFGXLLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPPAC
JGI24747J21853_100394913300001978Corn, Switchgrass And Miscanthus RhizosphereMTLMKSSRAGLFALAFGXLLSLFLSVPSYDVSYAQTQAPAAAPAAP
JGI24745J21846_101725313300002073Corn, Switchgrass And Miscanthus RhizosphereMTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPAAP
JGI24145J26757_1007537523300002183Arctic Peat SoilMTLKKPSRAGLVALALGVLLGLFLSVAAYNTSYAQPAP
JGI24034J26672_1001371833300002239Corn, Switchgrass And Miscanthus RhizosphereMTLMKSSRAGLFALAFGXLLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPPACANDPD
Ga0055455_1003799613300003990Natural And Restored WetlandsMTLKKPSRAGLLSLAFGILLGLFLSVAVYDASYAQTPAPAAAAPAA
Ga0058859_1143499923300004798Host-AssociatedMTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAAAPAAAPATP
Ga0066815_1002266533300005164SoilMTLMKSSRAGLLALAFGILLGLFLSVASYDVSYAQAQAPAAAPA
Ga0066810_1001604233300005169SoilMTLMKSSRAGLLALAFGILLGIFLSVSTYDASYAQTPAPAAAAAPPAPA
Ga0068999_1011227713300005205Natural And Restored WetlandsMTLKKSSRAGLLALAFGILLGLFLSVATYDATYAQAQAPAAAAPAA
Ga0065714_1028414933300005288Miscanthus RhizosphereMTLMKSSRAGLLALAFGILLGLFLSVASYDVSYAQAQAPAA
Ga0065712_1025184533300005290Miscanthus RhizosphereMTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPPACANDPD
Ga0070682_10187461813300005337Corn RhizosphereMTLKKFSRAGLLALAFGVLLGLCLSTTAFDTASAQPAPAAAPA
Ga0070711_10096852613300005439Corn, Switchgrass And Miscanthus RhizosphereMTLKKSSRAGLTALAFGILLGIILSVGVYSTSYAQAPAPG
Ga0070665_10102019313300005548Switchgrass RhizosphereMTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAAAPAAAPA
Ga0074470_11297541153300005836Sediment (Intertidal)MTLKKPSRAGLLSLAFGILLGLFLSVAVYDASYAQTPAPAAAA
Ga0075298_103932423300005880Rice Paddy SoilMTLKKSSRAGLIALAFGVLLGLSLSVATYDTSYAQAQA
Ga0066794_1013725413300005947SoilMTLKKSSRAGLLALAFGVLLGLFLSVAAYDASYAQAPATPP
Ga0075026_10047514213300006057WatershedsMTLKKSSRAGLKALAFGALLGFILSVGVHSASYAQAP
Ga0075015_10090750423300006102WatershedsMTLKKPSRAGLVALALGVLLSLFLSVAAYNTSYAQPAPGAAPA
Ga0075018_1040082033300006172WatershedsMTLKKPSRAGLLALALGVLLGLFLSVASFDASYAQAP
Ga0070716_10182676413300006173Corn, Switchgrass And Miscanthus RhizosphereMTFKKFSRAGLMALAFGVVLGLFLSVSLVDHSFAQDTAAAAS
Ga0070712_10012870913300006175Corn, Switchgrass And Miscanthus RhizosphereMTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAA
Ga0075037_188487613300006426Permafrost SoilMTLKKTSRAGLLALALGVLLGLFLSVASFDASYAQAPA
Ga0079220_1176168423300006806Agricultural SoilMTFKTLSRAGLLALAFGVLLTLCLSVASRDYGYAQTPAAPAAS
Ga0075518_105354533300006972Arctic Peat SoilMTLKKPSRAGLAALALGVLLGLFLSVAAYNTSYAQP
Ga0105238_1006804453300009551Corn RhizosphereMTLNKFSRAGLLALAHGVLLGLCLSTTAFDTASAQPAPAAGPAAAAP
Ga0105858_120451113300009661Permafrost SoilMTLKKPSRAGLAALALGVLLGLFLSVAAYTTSYAQPAPGAAP
Ga0114958_1033167213300009684Freshwater LakeMTLKKPSRAGLLSLCFGILLGVFLSVAVYDASYAQTPPPAAAP
Ga0126374_1167847023300009792Tropical Forest SoilMTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAAAPAA
Ga0134126_1001504013300010396Terrestrial SoilMTLKKSSRAGLLALAFGILLGIFLSVATYSTSYAQTPAPG
Ga0137389_1111440323300012096Vadose Zone SoilMTFKKSSRAGLLALAFGVLLGLFLSTASFDVSYAQTPAAAPAAAAAPPA
Ga0157299_1023724123300012899SoilMTLMKSSRAGLFALAFGILIGLFLSVSSYDISYAQTQAP
Ga0137410_1187980623300012944Vadose Zone SoilMTFKTLSRAGLVALAAGILLGLFLSLPTFDVSYAQA
Ga0164301_1002610043300012960SoilMTLKKSSRAGLLALAFGIVLGLFLSVATYDASYAQT
Ga0164305_1186982423300012989SoilMTLKKSSRAGLLALAFGIVLGLFLSVATYDASYAQTQAP
Ga0164283_107370613300013073SoilMTLKKVSRAGLLALALGVLLGLFLSVASFDAASAQTP
Ga0157370_1071701013300013104Corn RhizosphereMTLKKSSRAGLLALAFGILLGLFLSVASYDVSFAQAQAPAATA
Ga0120111_113869413300013764PermafrostMTLKKPSRAGLAALALGVLLGLFLSVAAYNTSYAQPAPAAAPAAPA
Ga0075359_105330413300014266Natural And Restored WetlandsMTLKKFTRAGLMGIALTVLLGLFLSVASFDASHAQAPA
Ga0075353_105105813300014321Natural And Restored WetlandsMTLKKSSRAGVVALAFGILLSLFLSVATYDTTYAQAQAPAAA
Ga0132257_10281124313300015373Arabidopsis RhizosphereMTLKKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAAA
Ga0187785_1009541913300017947Tropical PeatlandMTLKKSSRAGLMGLVLGAILAIILSVGVVSHSYAQAPAPGAAP
Ga0184608_1009380213300018028Groundwater SedimentMTLMKSSRAGLFALAFGILIGLFLSVATYEASYAQAQAPAA
Ga0184611_115912513300018067Groundwater SedimentMTLKKSSRAGLLALAFGILLGLFLSVAAYDASYAQAQAPAGAPAA
Ga0187774_1051691713300018089Tropical PeatlandMTLKKSSRAGLIALAFGVMFGIVLCLGLNTASAQAPAPGAAPAAA
Ga0210401_1124728813300020583SoilMTSKKTTRAGLFALALGVLLGLFLSVASINSSYAQAPAAPPAA
Ga0214182_102217033300020714FreshwaterMTLKKFSRAGLVAGALGILLGLFLSVASFDASYAQA
Ga0210397_1115961123300021403SoilMTSKKTTRAGLFALALGVLLGLFLSVASINSSYAQAPAAP
Ga0213878_1053708323300021444Bulk SoilMTSKNTARAGWFALALGVLFGLFLSVASVNSAFAQAPAAAPAAA
Ga0187846_1010018313300021476BiofilmMKSKKISRGGLWVLALGALFGLFLSVANINSSYAQSPAAQPAQAAATS
Ga0210402_1162364223300021478SoilMTSKKTARAGLFALALGVLLGLFLSVASINSSYAQAP
Ga0210410_1133601113300021479SoilMTSKKTARAGLFALALGVLLGLFLSVASINSSYAQAPAAPPAAEPAA
Ga0247786_100057613300022883SoilMTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPPACAND
Ga0247784_104313033300023270Plant LitterMTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPP
Ga0247691_103585523300024222SoilMTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAAAPA
Ga0247692_102920833300024279SoilMTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAP
Ga0208848_109777923300025509Arctic Peat SoilMTLKKPSRAGLAALALGVLLGLFLSVAAYNTSYAQPAP
Ga0208586_102477513300025588Arctic Peat SoilMTLIKSSRAGLLTLALGIMLGLFLSVATINSSHAQTPMAPAAAPA
Ga0208220_100873363300025627Arctic Peat SoilMTLKTPSRAGLLALAFGLLLALILSVSLYSTSYAQTPAPGATPAATAAPTPP
Ga0209638_116918613300025725Arctic Peat SoilMTLKKSSRAGLLALAFGVLLGLFLSVAAYDASYAQAPATPPAA
Ga0210100_100167733300025780Natural And Restored WetlandsMTLKKLSGAGLLALVFGVMLALFLSVATYDTSYAQT
Ga0209584_1009492933300025878Arctic Peat SoilMTLKKTSRAGLLALALGVLLGLFLSVASFDASYAQAPAP
Ga0209585_1012579733300025891Arctic Peat SoilMTLKKPSRAGLLSLCFGILLGLFLSVAVYDASFAQT
Ga0207680_1031656633300025903Switchgrass RhizosphereMTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQA
Ga0207685_1009077613300025905Corn, Switchgrass And Miscanthus RhizosphereMTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAATAAPPAP
Ga0207654_1042138633300025911Corn RhizosphereMTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAAAAAPPAP
Ga0207663_1043523513300025916Corn, Switchgrass And Miscanthus RhizosphereMTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQAPAA
Ga0207670_1122593813300025936Switchgrass RhizosphereMTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAP
Ga0207668_1128143813300025972Switchgrass RhizosphereMTLKKSSRAGLLALAFGILLGLFLSVATYDASYAQAQAPAAAAAPP
Ga0208290_101792433300026066Natural And Restored WetlandsMTLKKLSGAGLLALVFGVMLALCLSVATYDTSYAQ
Ga0207575_10188123300026748SoilMTLMKSSRAGLFALAFGILMCLFLSVAHDVAYAQAQ
Ga0207605_10089813300026757SoilMTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPA
Ga0207595_10206913300026782SoilMTLMKSSRAGLLALAFGILLGLFLSVASYDVSYAQAQAPAAAPAA
Ga0207634_10119733300026818SoilMTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAPAAAPAAPAAPPPA
Ga0207502_10021333300026828SoilMTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQA
Ga0207804_12318013300026849Tropical Forest SoilMTLKKSSRAGLLALAFGILLGLFLSVASFDASYAQ
Ga0208762_100141813300026870SoilMTLKKSSRAGLVALALGIMLGLFLSVASFDASYAQAPAPERTKRR
Ga0207803_104499113300027000Tropical Forest SoilMTLKKSSRAGLLALAFGILLGLFLSVASFDASYAQAPAP
Ga0209982_102030733300027552Arabidopsis Thaliana RhizosphereMTLMKSSRAGLFALAFGILLSLFLSVPSYDVSYAQTQAP
Ga0209178_100691613300027725Agricultural SoilMTLKKSSRAGLLALAFGIVLGLFLSVASYDVSYAQA
Ga0209177_1008489733300027775Agricultural SoilMTLMKSSRAGLFALAFGIVLGLFLSVSSYDISYAQTQAPAAAPAAPAAPPPA
Ga0307323_1000346513300028787SoilMTLKKSSRAGLFALAFGILIGLFLSVATYEASYAQAQAPAAAPAAA
Ga0265338_1110372313300028800RhizosphereMTLKKPSRAGLTALVFGILLALVLSVSLQSSSYAQAPAPGAAPAP
Ga0307296_1070911713300028819SoilMTFKKSSRAGLFALAFGILIGLFLSVATYEASYAQAQAPAAAPAAA
Ga0307312_1110476013300028828SoilMTFKKSSRAGLFALAFGILIGLFLSVATYEASYAQAQAPAAAAPPAP
Ga0310886_1043242323300031562SoilMTLKKLTRAGLAALAFGAALGIFLNFASINSSYAQAPAA
Ga0318500_1052937623300031724SoilMTLMKSPRAGLLALAFGVVLSLFLSVAAFDASYAQPAPGAA
Ga0302321_10358504813300031726FenMTLKKFSRAGLVGIALTVLLGLFLSVASFDASHAQAP
Ga0307468_10082646123300031740Hardwood Forest SoilMTLMKSSRAGLFALAFGILLGLFLSVPSYDVSYAQTQAPAAAPAA
Ga0318554_1069849723300031765SoilMTLKKSSRAGLFALAFGILMCLFLSVAHDVAYAQAPAAAPAAAPAT
Ga0310907_1038221513300031847SoilMTLKKLTRAGLAALAFGAALGIFLNFASINSSYAQAPAAPAA
Ga0306919_1149108223300031879SoilMTLKKSSRAGLVALAFGILLGLFLSVATYDASFAQA
Ga0306923_1006094863300031910SoilMTLMKFPRAGLLALALGVVLSVFLSVAAFDASYAQPAPGAAPAA
Ga0214473_1178772023300031949SoilMTLKKSSRAGLLALAFGVLLGLFLSVAAYDTSYAQAP
Ga0307479_1041205433300031962Hardwood Forest SoilMTSKKTARAGLFALALGVLLGLFLSVASINSSYAQAPAAPP
Ga0318504_1041495223300032063SoilMTLMKSPRAGLLALAFGVVLSLFLSVAAFDASYAQPAPGAAPAAPA
Ga0315276_1149899023300032177SedimentMTLKKISRAGLLALVLGTVLGLFLSVASFDASYAQTLAPA
Ga0335085_1101608513300032770SoilMTLKKSSRAGLTALAFGILLGIILSVGLYSTSYAQAPAPG
Ga0335080_1192430123300032828SoilMTLKKSSRAGLLALAFGILLGLFLSVGTINSSYAQTPPAPAAAPAPAPA
Ga0335081_1211469713300032892SoilMTFKRSSRAGLKALAFGALLGFILSVGVHSASYAQAPAAPAAAPA
Ga0310914_1182263023300033289SoilMTLKKSSRAGLVALAFGILLGLFLSVATYDASFAQ
Ga0310811_1110193813300033475SoilMTLNKFSRAGLLALAFGVLLGLCLSMTTFDTSSAQPAPAAAPA
Ga0314801_129729_457_5913300034676SoilMTLMKSSRAGLLALAFGILLGLFLSVASYDVSYAQAQAPAAAPAT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.