Basic Information | |
---|---|
Family ID | F064733 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 44 residues |
Representative Sequence | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 82.81 % |
% of genes near scaffold ends (potentially truncated) | 20.31 % |
% of genes from short scaffolds (< 2000 bps) | 83.59 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.406 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.750 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.562 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.469 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.56% Coil/Unstructured: 69.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF04828 | GFA | 7.81 |
PF13238 | AAA_18 | 3.12 |
PF07883 | Cupin_2 | 2.34 |
PF00583 | Acetyltransf_1 | 1.56 |
PF00903 | Glyoxalase | 1.56 |
PF00756 | Esterase | 0.78 |
PF13561 | adh_short_C2 | 0.78 |
PF00174 | Oxidored_molyb | 0.78 |
PF02311 | AraC_binding | 0.78 |
PF13302 | Acetyltransf_3 | 0.78 |
PF02371 | Transposase_20 | 0.78 |
PF04191 | PEMT | 0.78 |
PF01361 | Tautomerase | 0.78 |
PF00211 | Guanylate_cyc | 0.78 |
PF03992 | ABM | 0.78 |
PF00005 | ABC_tran | 0.78 |
PF01850 | PIN | 0.78 |
PF00144 | Beta-lactamase | 0.78 |
PF06146 | PsiE | 0.78 |
PF00075 | RNase_H | 0.78 |
PF00916 | Sulfate_transp | 0.78 |
PF13508 | Acetyltransf_7 | 0.78 |
PF02687 | FtsX | 0.78 |
PF01548 | DEDD_Tnp_IS110 | 0.78 |
PF03193 | RsgA_GTPase | 0.78 |
PF13240 | zinc_ribbon_2 | 0.78 |
PF02861 | Clp_N | 0.78 |
PF13669 | Glyoxalase_4 | 0.78 |
PF04439 | Adenyl_transf | 0.78 |
PF00274 | Glycolytic | 0.78 |
PF13473 | Cupredoxin_1 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 7.81 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.56 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.78 |
COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.78 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.78 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.78 |
COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.78 |
COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.78 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.78 |
COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 0.78 |
COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.78 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.19 % |
Unclassified | root | N/A | 7.81 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725009|PermFrostAlaska_NODE_19238_len_1210_cov_25_718182 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
2124908036|A5_v_NODE_3630_len_614_cov_16_633551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 664 | Open in IMG/M |
3300002066|JGIcombinedJ21911_10118905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 767 | Open in IMG/M |
3300002071|JGIcombinedJ21915_10012208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3868 | Open in IMG/M |
3300002071|JGIcombinedJ21915_10098303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1175 | Open in IMG/M |
3300002538|JGI24132J36420_10166000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 556 | Open in IMG/M |
3300002538|JGI24132J36420_10182371 | Not Available | 521 | Open in IMG/M |
3300002563|JGI24138J36424_10007268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3783 | Open in IMG/M |
3300002569|JGI24136J36422_10068685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1003 | Open in IMG/M |
3300004081|Ga0063454_101622283 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300004114|Ga0062593_100431846 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300004463|Ga0063356_100449382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1681 | Open in IMG/M |
3300005093|Ga0062594_103089321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
3300005166|Ga0066674_10274641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 795 | Open in IMG/M |
3300005172|Ga0066683_10611961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 658 | Open in IMG/M |
3300005181|Ga0066678_10446604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 860 | Open in IMG/M |
3300005187|Ga0066675_11197906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 563 | Open in IMG/M |
3300005294|Ga0065705_10675506 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300005446|Ga0066686_11001235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 543 | Open in IMG/M |
3300005540|Ga0066697_10792573 | Not Available | 515 | Open in IMG/M |
3300005552|Ga0066701_10525775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 729 | Open in IMG/M |
3300005556|Ga0066707_10288039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1075 | Open in IMG/M |
3300005560|Ga0066670_10885799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 543 | Open in IMG/M |
3300005569|Ga0066705_10565303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 703 | Open in IMG/M |
3300005586|Ga0066691_10554108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 685 | Open in IMG/M |
3300005947|Ga0066794_10161739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 673 | Open in IMG/M |
3300006055|Ga0097691_1049150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1476 | Open in IMG/M |
3300006058|Ga0075432_10578665 | Not Available | 511 | Open in IMG/M |
3300006426|Ga0075037_1024754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 542 | Open in IMG/M |
3300006642|Ga0075521_10019045 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
3300006642|Ga0075521_10137336 | Not Available | 1141 | Open in IMG/M |
3300006795|Ga0075520_1226480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 784 | Open in IMG/M |
3300006797|Ga0066659_11250259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 619 | Open in IMG/M |
3300007821|Ga0104323_111085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1210 | Open in IMG/M |
3300009029|Ga0066793_10042220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 2567 | Open in IMG/M |
3300009038|Ga0099829_10530525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
3300009137|Ga0066709_100422067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1857 | Open in IMG/M |
3300009176|Ga0105242_10461407 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300009660|Ga0105854_1001313 | All Organisms → cellular organisms → Bacteria | 10268 | Open in IMG/M |
3300010320|Ga0134109_10252989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 665 | Open in IMG/M |
3300010323|Ga0134086_10169619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 804 | Open in IMG/M |
3300010335|Ga0134063_10264564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 821 | Open in IMG/M |
3300011271|Ga0137393_10332174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1297 | Open in IMG/M |
3300011987|Ga0120164_1000186 | All Organisms → cellular organisms → Bacteria | 38882 | Open in IMG/M |
3300011996|Ga0120156_1000687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12328 | Open in IMG/M |
3300011997|Ga0120162_1000714 | All Organisms → cellular organisms → Bacteria | 17791 | Open in IMG/M |
3300011998|Ga0120114_1019549 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300012010|Ga0120118_1040053 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300012092|Ga0136621_1009307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4052 | Open in IMG/M |
3300012096|Ga0137389_10911812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 754 | Open in IMG/M |
3300012189|Ga0137388_10666581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 966 | Open in IMG/M |
3300012198|Ga0137364_11348359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 530 | Open in IMG/M |
3300012200|Ga0137382_11251185 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300012201|Ga0137365_11230275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 534 | Open in IMG/M |
3300012204|Ga0137374_10211032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1662 | Open in IMG/M |
3300012208|Ga0137376_11435943 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300012209|Ga0137379_10239340 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
3300012210|Ga0137378_10805465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 852 | Open in IMG/M |
3300012211|Ga0137377_10712742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 938 | Open in IMG/M |
3300012285|Ga0137370_10189379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1204 | Open in IMG/M |
3300012285|Ga0137370_10199456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1173 | Open in IMG/M |
3300012350|Ga0137372_10096912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 2481 | Open in IMG/M |
3300012350|Ga0137372_10137060 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
3300012356|Ga0137371_10415059 | Not Available | 1043 | Open in IMG/M |
3300012356|Ga0137371_11106665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 595 | Open in IMG/M |
3300012357|Ga0137384_10384925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1160 | Open in IMG/M |
3300012361|Ga0137360_10860889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 781 | Open in IMG/M |
3300012398|Ga0134051_1314528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 610 | Open in IMG/M |
3300012927|Ga0137416_10785900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 841 | Open in IMG/M |
3300012929|Ga0137404_10507893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1076 | Open in IMG/M |
3300013297|Ga0157378_10860349 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300013765|Ga0120172_1079680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 810 | Open in IMG/M |
3300014827|Ga0120171_1052522 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
3300014839|Ga0182027_12208903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 522 | Open in IMG/M |
3300017789|Ga0136617_10003992 | All Organisms → cellular organisms → Bacteria | 13186 | Open in IMG/M |
3300018028|Ga0184608_10029279 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
3300018031|Ga0184634_10264132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 789 | Open in IMG/M |
3300018051|Ga0184620_10171630 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300018053|Ga0184626_10428748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 523 | Open in IMG/M |
3300018054|Ga0184621_10231505 | Not Available | 661 | Open in IMG/M |
3300018066|Ga0184617_1192825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 606 | Open in IMG/M |
3300018071|Ga0184618_10167050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 907 | Open in IMG/M |
3300018076|Ga0184609_10178869 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300018433|Ga0066667_10783510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 808 | Open in IMG/M |
3300019279|Ga0184642_1623236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 503 | Open in IMG/M |
3300019867|Ga0193704_1039501 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300019881|Ga0193707_1027402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1871 | Open in IMG/M |
3300020001|Ga0193731_1001837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5707 | Open in IMG/M |
3300020018|Ga0193721_1109772 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300020022|Ga0193733_1094943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 834 | Open in IMG/M |
3300022534|Ga0224452_1220566 | Not Available | 582 | Open in IMG/M |
3300025484|Ga0208587_1068865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 774 | Open in IMG/M |
3300025544|Ga0208078_1027129 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
3300025553|Ga0208080_1104331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 583 | Open in IMG/M |
3300025664|Ga0208849_1160902 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300025692|Ga0209744_1201754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 607 | Open in IMG/M |
3300025716|Ga0209746_1025843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2185 | Open in IMG/M |
3300025725|Ga0209638_1176328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 664 | Open in IMG/M |
3300025750|Ga0209747_1159135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 711 | Open in IMG/M |
3300025836|Ga0209748_1104544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1084 | Open in IMG/M |
3300025852|Ga0209124_10233379 | Not Available | 715 | Open in IMG/M |
3300025857|Ga0209014_10014228 | All Organisms → cellular organisms → Bacteria | 4000 | Open in IMG/M |
3300025891|Ga0209585_10084882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1188 | Open in IMG/M |
3300025913|Ga0207695_10390139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
3300025981|Ga0207640_10635524 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300026275|Ga0209901_1004453 | All Organisms → cellular organisms → Bacteria | 4123 | Open in IMG/M |
3300026332|Ga0209803_1030799 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
3300026342|Ga0209057_1186620 | Not Available | 594 | Open in IMG/M |
3300027562|Ga0209735_1077538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 720 | Open in IMG/M |
3300027591|Ga0209733_1098183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 740 | Open in IMG/M |
3300027862|Ga0209701_10331997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 865 | Open in IMG/M |
3300027882|Ga0209590_10269892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1088 | Open in IMG/M |
3300027915|Ga0209069_10513912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 677 | Open in IMG/M |
3300028563|Ga0265319_1052661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1339 | Open in IMG/M |
3300028577|Ga0265318_10350716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 539 | Open in IMG/M |
3300028717|Ga0307298_10128549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 729 | Open in IMG/M |
3300028791|Ga0307290_10003859 | All Organisms → cellular organisms → Bacteria | 4834 | Open in IMG/M |
3300028799|Ga0307284_10379273 | Not Available | 574 | Open in IMG/M |
3300028814|Ga0307302_10217427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 934 | Open in IMG/M |
3300028876|Ga0307286_10083889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A1 | 1108 | Open in IMG/M |
3300030993|Ga0308190_1088232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 662 | Open in IMG/M |
3300031058|Ga0308189_10241586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 677 | Open in IMG/M |
3300031081|Ga0308185_1034231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 622 | Open in IMG/M |
3300031226|Ga0307497_10022620 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
3300031421|Ga0308194_10293679 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300031740|Ga0307468_100437415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 1014 | Open in IMG/M |
3300033233|Ga0334722_10014074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7159 | Open in IMG/M |
3300033891|Ga0334811_013093 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.75% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 17.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.94% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.25% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 6.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.12% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 2.34% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.56% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.56% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.78% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.78% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.78% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.78% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725009 | Permafrost microbial communities from central Alaska, USA - Permafrost field sample | Environmental | Open in IMG/M |
2124908036 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
3300002066 | Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004) | Environmental | Open in IMG/M |
3300002071 | Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
3300002538 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 | Environmental | Open in IMG/M |
3300002563 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 | Environmental | Open in IMG/M |
3300002569 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011987 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M | Environmental | Open in IMG/M |
3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
3300025716 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes) | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025750 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 (SPAdes) | Environmental | Open in IMG/M |
3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026275 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
draft_perm_00105990 | 2067725009 | Permafrost | MTITQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
A5_v_00080350 | 2124908036 | Soil | QTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
JGIcombinedJ21911_101189052 | 3300002066 | Arctic Peat Soil | TITQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
JGIcombinedJ21915_100122084 | 3300002071 | Arctic Peat Soil | MTITQTIYVELLDEGIVVYRPVEATPDPDGALRLPATAPADEHG* |
JGIcombinedJ21915_100983031 | 3300002071 | Arctic Peat Soil | MTNTQTIYVKLLDEGVVVYRPVEATPDPDGVLRLPATAPAD |
JGI24132J36420_101660001 | 3300002538 | Arctic Peat Soil | MTITQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
JGI24132J36420_101823712 | 3300002538 | Arctic Peat Soil | MTNTQTIYVKLLDEGVVVYRPVEATPDPDGVLRLPATAPADE |
JGI24138J36424_100072684 | 3300002563 | Arctic Peat Soil | MTXTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
JGI24136J36422_100686853 | 3300002569 | Arctic Peat Soil | MTITQTIYVELLDEGVVVYRPVEATPDPDGALRLPATAPADEHG* |
Ga0063454_1016222832 | 3300004081 | Soil | MANTQTIYVDLLGEGVVVYWPVEATPDPDGVLRRPATAPAEEHG* |
Ga0062593_1004318462 | 3300004114 | Soil | MTNTRTIHVELLDEGVAVYRLVEATSNPHGVLRLPGDNAADAHG* |
Ga0063356_1004493822 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTNTRTIHVELLDEGVAVYRLVEATSNAHGVLRLPGDNAADAHG* |
Ga0062594_1030893211 | 3300005093 | Soil | MTNTQTTYVELLDEGVVVYRPVEATPNPDGVLRLPATAPAAEHG* |
Ga0066674_102746412 | 3300005166 | Soil | MTNTQTIYVELVDEGVLVYRPVEATPDPDGVLRPPATAPADEHG* |
Ga0066683_106119612 | 3300005172 | Soil | MANTQTIYVDLLDEGVVVYWPVEATPNPDGVLRLPATAPADEHG* |
Ga0066678_104466042 | 3300005181 | Soil | MTNTQTIYVELVDEGVLVYRPVEATPDPDGVLRRPATAPADEHG* |
Ga0066675_111979062 | 3300005187 | Soil | MTNTQTIYVELLDEGVVVCRPVEATPNPDGVLRLPTTAPADEHG* |
Ga0065705_106755062 | 3300005294 | Switchgrass Rhizosphere | MSLNDLDRFAGMTNTQTTYVELLDEGVVVYRPVEATPNPDGVLRLPATAPAAEHG* |
Ga0066686_110012351 | 3300005446 | Soil | MTNTQTIYVELLDEGVVVCRPVEATPNPDGVLRLPATAPADEHG* |
Ga0066697_107925731 | 3300005540 | Soil | MTNTQTIYVELVDEGVLVYRPVEATPDPDGVLRLPAAAPADEHG* |
Ga0066701_105257752 | 3300005552 | Soil | MTNTQTIYVELLDEGVVVYRPVEATPNPDGVLRLPATAPADEHG* |
Ga0066707_102880392 | 3300005556 | Soil | MTNTQTIYVELVDEGVLVYRPVEATPDPDRVLRLPATAPADEHG* |
Ga0066670_108857991 | 3300005560 | Soil | MANTQTIYVELLDESVVVYLPVEATPNPDGVLRLPATAPADEHG* |
Ga0066705_105653032 | 3300005569 | Soil | MTNTQTIYAELVDEGVLVYRPVAATPDPDGVLRLPATALADEHG* |
Ga0066691_105541082 | 3300005586 | Soil | MTNTQTIDVELLDEGVAVYRPVEATPDPDGVLRVLATAPAGEHG* |
Ga0066794_101617392 | 3300005947 | Soil | LLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0097691_10491503 | 3300006055 | Arctic Peat Soil | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0075432_105786651 | 3300006058 | Populus Rhizosphere | MTNTQTVYVELLDTGVVVYPPVEATPNPDGVLTPAAEHG* |
Ga0075037_10247541 | 3300006426 | Permafrost Soil | TNTQTIYAELHDERVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0075521_100190453 | 3300006642 | Arctic Peat Soil | MTNAQTIDVELLDEGVVVYRPVEATPDPDGVLRLRATAPADEHG* |
Ga0075521_101373361 | 3300006642 | Arctic Peat Soil | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEH |
Ga0075520_12264803 | 3300006795 | Arctic Peat Soil | MTNTQTIYVKLLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0066659_112502592 | 3300006797 | Soil | QTIYVELLDEGVVVYRPVEAIPGPDGVLRLPATAPADEHG* |
Ga0104323_1110853 | 3300007821 | Soil | MTNTQTIYVELLDEGDVVYRPVAATPDPDGVLRLPATAPADEHG* |
Ga0066793_100422203 | 3300009029 | Prmafrost Soil | MTITQTIYVDLLDEGVVVYRPVEAAPDPDGVLRLPATAPADEHG* |
Ga0099829_105305252 | 3300009038 | Vadose Zone Soil | MTNTQTLYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0066709_1004220672 | 3300009137 | Grasslands Soil | MTNTQTIYVELLAEGVVVYRPVEATPDPDGVLRLPAAAPADEHG* |
Ga0105242_104614072 | 3300009176 | Miscanthus Rhizosphere | MTNTQTTYVELLDEGVVVYRPVEATPNPDGVLRLPATAPADEHG* |
Ga0105854_100131311 | 3300009660 | Permafrost Soil | MTNTQTIYAELHDERVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0134109_102529891 | 3300010320 | Grasslands Soil | MANTQTIYVELLDESVVVYLPVEAIPNPDGVLRLPTTAPADEHG* |
Ga0134086_101696191 | 3300010323 | Grasslands Soil | PERSGWVAGMTNTQTIYVELVDEGVLVYRPVEATPDPDGVLRPPATAPADEHG* |
Ga0134063_102645642 | 3300010335 | Grasslands Soil | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPAAAPADEHG* |
Ga0137393_103321741 | 3300011271 | Vadose Zone Soil | MTNTRTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0120164_100018622 | 3300011987 | Permafrost | MTNTQTIYVDLLDEGVLVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0120156_10006876 | 3300011996 | Permafrost | MTNAQTICVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0120162_100071412 | 3300011997 | Permafrost | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPANEHG* |
Ga0120114_10195492 | 3300011998 | Permafrost | MTNTQTIYVELLDEGVVAYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0120118_10400531 | 3300012010 | Permafrost | GMTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0136621_10093076 | 3300012092 | Polar Desert Sand | MTNTQTIFVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0137389_109118121 | 3300012096 | Vadose Zone Soil | MTNTRTTYVELVDEGVAVYRPVEATPDPDGVLRLLATAPADEHG* |
Ga0137388_106665813 | 3300012189 | Vadose Zone Soil | MTNTRTTYVELVDEGVAVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0137364_113483592 | 3300012198 | Vadose Zone Soil | MTKTQAIYVELVDEGVLVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0137382_112511851 | 3300012200 | Vadose Zone Soil | MTNTQTIYVELLDEGVVVYWPVEATPDPDGVLRRPATAPADEHG* |
Ga0137365_112302751 | 3300012201 | Vadose Zone Soil | MTNTQTIYVELLDEGVLVYRPVAATPDPDGVLRLPATAPADEHG* |
Ga0137374_102110323 | 3300012204 | Vadose Zone Soil | MTNTQTICVELLDEGVVVYRPVEAIPDPDGVLRLPATAPADEHG* |
Ga0137376_114359432 | 3300012208 | Vadose Zone Soil | MTNTQTIYVELLDEGVVVYRSVEATPNPDSALRLPATTPADEHG* |
Ga0137379_102393403 | 3300012209 | Vadose Zone Soil | MTNTQTIYVELLDEGVLVYRPVAATPDPDGVLRLPATAPAGERG* |
Ga0137378_108054651 | 3300012210 | Vadose Zone Soil | MNNMQTIYVELLDEGVVVYRPVEATPNPDGVLRLPATAPADEHG* |
Ga0137377_107127421 | 3300012211 | Vadose Zone Soil | MTNTQTIYVELVDEGVLVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0137370_101893791 | 3300012285 | Vadose Zone Soil | LLDEGLVVYCAVEATPDPDGVLRRPATPPADERG* |
Ga0137370_101994563 | 3300012285 | Vadose Zone Soil | MTNTQTIHAELVDEGILVYRPVEATPDPDGGLCLPATAPADEHG* |
Ga0137372_100969123 | 3300012350 | Vadose Zone Soil | MTNTQTIYVELVDEDVLVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0137372_101370602 | 3300012350 | Vadose Zone Soil | MTDKQTIYVELLDDSVTAYRPVEATQDRDGSFRLQEPP* |
Ga0137371_104150591 | 3300012356 | Vadose Zone Soil | MTDTQTIYVELLDEGVTAYRPVEVTRDQDGSFRLPDSAPADEV |
Ga0137371_111066651 | 3300012356 | Vadose Zone Soil | MANTQTIYVELLDEGVVVYRPVEATPNPDGVLRLPATAPADEHG* |
Ga0137384_103849252 | 3300012357 | Vadose Zone Soil | MANTQTIYVELLDEGVVVYWPVEATPDPEGVLRRPATAPADEHG* |
Ga0137360_108608892 | 3300012361 | Vadose Zone Soil | MTNTQTIYVELLDEGVAVYRPVEATPDPDGVLRLLATAPAGEHG* |
Ga0134051_13145282 | 3300012398 | Grasslands Soil | MANTQTIYVELLDEGVVVYWPVEATPNPDGVLRLPATAPADEHG* |
Ga0137416_107859003 | 3300012927 | Vadose Zone Soil | MTNTQTIYVELLDEGVVVYRPVEATSNPDGVLRLPATAPADEHG* |
Ga0137404_105078931 | 3300012929 | Vadose Zone Soil | MTNTQTIDVELLDEGVAVYRPVEATPDPDGVLRLLATAPASEHG* |
Ga0157378_108603493 | 3300013297 | Miscanthus Rhizosphere | MTTTQTTYVELLDEGVVVYRPVEATPNPDGVLRLPATAPAAEHG* |
Ga0120172_10796802 | 3300013765 | Permafrost | MTTVQTIYVELLDEGVVVDRPVEATPDPDGVLCLPATAPADEHG* |
Ga0120171_10525223 | 3300014827 | Permafrost | MTNTQTIYVDLLDEGVLVYRPVEATPDPDGVLRLPATAPADE |
Ga0182027_122089031 | 3300014839 | Fen | MTITQTIYVKLLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG* |
Ga0136617_100039922 | 3300017789 | Polar Desert Sand | MTNTQTIFVELLDEGVVVYRPVEATSDPGGVLRLPATAPADEHG |
Ga0184608_100292794 | 3300018028 | Groundwater Sediment | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAAADEHG |
Ga0184634_102641321 | 3300018031 | Groundwater Sediment | MTNTQTIYVELLDEGVVVYRPVEATCDSDVLRLPATAPADEHG |
Ga0184620_101716302 | 3300018051 | Groundwater Sediment | MTNTQTIYVELLDEGVVVYRPVEASPDPDGVLRLPATAAADEHG |
Ga0184626_104287482 | 3300018053 | Groundwater Sediment | MTNTQTIYVELLEEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0184621_102315051 | 3300018054 | Groundwater Sediment | MTNTQTIYVELVDEGVLVYRPVEATPDPDGVLRLPATAAADEHG |
Ga0184617_11928251 | 3300018066 | Groundwater Sediment | MTNTQTIYVELLDDGVVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0184618_101670503 | 3300018071 | Groundwater Sediment | MTNTQTIYVELLDEGVVVCRPVEATPDPDGVLRLPATAPADERG |
Ga0184609_101788693 | 3300018076 | Groundwater Sediment | MTITQTIYVELVDEGVLVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0066667_107835102 | 3300018433 | Grasslands Soil | MTNTQTIYVGLLDEGVVVYPLVETTPDPDGVLRLPATAPADEHG |
Ga0184642_16232362 | 3300019279 | Groundwater Sediment | MTNAQTIYVELVDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0193704_10395011 | 3300019867 | Soil | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPVDEHG |
Ga0193707_10274022 | 3300019881 | Soil | MTNTQTIYAELVDEGVVVYRPVEATPDPDGALRLPATAPADEHG |
Ga0193731_10018379 | 3300020001 | Soil | MTNTQTTYAELVDEGVVVYRPVEATPDPDGALRLPATAPADEHG |
Ga0193721_11097722 | 3300020018 | Soil | MTKTQTIYVELLDEGVVVYRPVEATPNPDGALRLPATAPADEHG |
Ga0193733_10949432 | 3300020022 | Soil | MTNTQTIYVELLDEGVVLYRPVEATPNPDGALRLPATAPADEHG |
Ga0224452_12205662 | 3300022534 | Groundwater Sediment | MTNTQTIYVELVDEGVLVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0208587_10688651 | 3300025484 | Arctic Peat Soil | GMTITQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0208078_10271293 | 3300025544 | Arctic Peat Soil | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPVTAPADEHG |
Ga0208080_11043312 | 3300025553 | Arctic Peat Soil | ELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0208849_11609022 | 3300025664 | Arctic Peat Soil | MTNTQTIYVELFDEVVLVYRPVEATPDPDGVLRPPATAPADEH |
Ga0209744_12017541 | 3300025692 | Arctic Peat Soil | NTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0209746_10258434 | 3300025716 | Arctic Peat Soil | MTNTQTIYVKLLDEGVVVYRPVEATPDPDGVLRLPATAPADEH |
Ga0209638_11763282 | 3300025725 | Arctic Peat Soil | MTNTQTIYVELLDEGDAVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0209747_11591352 | 3300025750 | Arctic Peat Soil | MTNTQTIYVELLDEGIVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0209748_11045442 | 3300025836 | Arctic Peat Soil | MTNTQTIYVELLDEGIVVYRPVEAAPDPDGALRLPATAPADDHG |
Ga0209124_102333791 | 3300025852 | Arctic Peat Soil | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPA |
Ga0209014_100142281 | 3300025857 | Arctic Peat Soil | TITQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0209585_100848822 | 3300025891 | Arctic Peat Soil | MTNTQTIYVELLDEGVVVYRPVEATPDPDGLLRLPATAPADEHG |
Ga0207695_103901391 | 3300025913 | Corn Rhizosphere | MTNTQTTYVELLDEGVVVYRPVEATPNPDGVLRLPATAPAAEHG |
Ga0207640_106355241 | 3300025981 | Corn Rhizosphere | LNDLDRFAGMTNTQTTYVELLDEGVVVYRPVEATPNPDGVLRLPATAPAAEHG |
Ga0209901_10044536 | 3300026275 | Permafrost Soil | MTNTQTIYAELHDERVVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0209803_10307992 | 3300026332 | Soil | MTNTQTIYVELVDEGVLVYRPVEATPDPDGVLRPPATAPADEHG |
Ga0209057_11866201 | 3300026342 | Soil | MTNTQTIYVELVDEGVLVYRPVEATPDPDGVLRPPATAP |
Ga0209735_10775382 | 3300027562 | Forest Soil | MTNAQTIYVELLDEGLVVYRPVESTPNPDGILRRPATAPADEHG |
Ga0209733_10981832 | 3300027591 | Forest Soil | MTNAQTLYVELLDEGVVVYRPVEAKPDPDGVLRLPATAPADERG |
Ga0209701_103319972 | 3300027862 | Vadose Zone Soil | MTNTQTIYVELLDEGVVVYRPVEATPDPDSVLRLPATAPADEHG |
Ga0209590_102698922 | 3300027882 | Vadose Zone Soil | MTNTQTIYVELLDEGVVVYRPVEATPNPDGVLRLPATAPADEHG |
Ga0209069_105139122 | 3300027915 | Watersheds | MTNAQTIYVELLDEGVVVYRPVEATPDLDGVLRLPATAPADEHG |
Ga0265319_10526612 | 3300028563 | Rhizosphere | MTNTQTIYVELLDEGVVVYRPVEATPDPDCVLRLPATAPADEHG |
Ga0265318_103507162 | 3300028577 | Rhizosphere | MTNTQTINVELLDEDVMVYRPVEATPDPHAVLRLPATAPADEHG |
Ga0307298_101285492 | 3300028717 | Soil | MTNTQTIYVELLDDCVVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0307290_100038598 | 3300028791 | Soil | TIYVELVDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0307284_103792731 | 3300028799 | Soil | MTITQTIYVELVDEGVLVYRPVEATPDPDGVLRLPATAPVDEHG |
Ga0307302_102174271 | 3300028814 | Soil | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPATAPVD |
Ga0307286_100838892 | 3300028876 | Soil | MTNTQTIYVELLDEGVVVYRPVEATPDPDGELRLPATAPA |
Ga0308190_10882323 | 3300030993 | Soil | VELVDEGVVVYRPVEATPDPDGVTSSSGDSARRRAWLNGTI |
Ga0308189_102415862 | 3300031058 | Soil | MTNTQTTYAELVDEGVVVYRPVEATPDPDGVLRLPATAPADRAWLNGTI |
Ga0308185_10342311 | 3300031081 | Soil | MTNTQTIYVELLDEGAVVYRPVEATPDPDGVLRLPATAPADEHG |
Ga0307497_100226202 | 3300031226 | Soil | MTNTQTIDVELLPEGVVVYGLVEATHDPDGVLRLPATAPADEHG |
Ga0308194_102936792 | 3300031421 | Soil | MTNTQTIYAELVDEGVVVYRPVEATPDPDGVLRLPATAPVDEHG |
Ga0307468_1004374152 | 3300031740 | Hardwood Forest Soil | MTNTQTIYVELLDEGVVVYRPVEATPKPDGVLRLPVKAPADEHG |
Ga0334722_100140746 | 3300033233 | Sediment | MTNTQTIYVELLDEGVVVYRPVEATPDPDGVLRLPAPAPADEHG |
Ga0334811_013093_1837_1971 | 3300033891 | Soil | MTNTQTIYVKLLDEGVVVYRPVEATPDPDGVLRLPATAPADEHG |
⦗Top⦘ |