Metagenome / Metatranscriptome Family F065781

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F065781
Family Type	Metagenome / Metatranscriptome
Number of Sequences	127
Average Sequence Length	40 residues
Representative Sequence	MSEGDRAGWWAIVYLLMVGAAAYFTIFMIIFSFVKKLFWS
Number of Associated Samples	87
Number of Associated Scaffolds	127

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	89.76 %
% of genes near scaffold ends (potentially truncated)	4.72 %
% of genes from short scaffolds (< 2000 bps)	75.59 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (43.307 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (11.811 % of family members)
Environment Ontology (ENVO)	Unclassified (39.370 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (54.331 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.56
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 127 Family Scaffolds
PF13671	AAA_33	3.15
PF08410	DUF1737	1.57
PF14743	DNA_ligase_OB_2	1.57
PF13394	Fer4_14	1.57
PF01541	GIY-YIG	0.79
PF00149	Metallophos	0.79
PF04851	ResIII	0.79
PF16473	Rv2179c-like	0.79
PF00011	HSP20	0.79
PF09722	Xre_MbcA_ParS_C	0.79
PF05496	RuvB_N	0.79
PF00133	tRNA-synt_1	0.79
PF11750	DUF3307	0.79
PF13192	Thioredoxin_3	0.79
PF00004	AAA	0.79
PF04679	DNA_ligase_A_C	0.79
PF01176	eIF-1a	0.79
PF00768	Peptidase_S11	0.79
PF09967	DUF2201	0.79
PF12850	Metallophos_2	0.79
PF09511	RNA_lig_T4_1	0.79
PF04293	SpoVR	0.79
PF00782	DSPc	0.79
PF08722	Tn7_TnsA-like_N	0.79
PF05118	Asp_Arg_Hydrox	0.79

COG ID	Name	Functional Category	% Frequency in 127 Family Scaffolds
COG0060	Isoleucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.79
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.79
COG0143	Methionyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.79
COG0361	Translation initiation factor IF-1	Translation, ribosomal structure and biogenesis [J]	0.79
COG0495	Leucyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.79
COG0525	Valyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.79
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.79
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.79
COG2255	Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB	Replication, recombination and repair [L]	0.79
COG2719	Stage V sporulation protein SpoVR/YcgB, involved in spore cortex formation (function unknown)	Cell cycle control, cell division, chromosome partitioning [D]	0.79
COG3555	Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily	Posttranslational modification, protein turnover, chaperones [O]	0.79

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.20 %
Unclassified	root	N/A	37.80 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	61.42 %
Unclassified	root	N/A	37.80 %
cellular organisms	root	All Organisms → cellular organisms	0.79 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	43.31 %
Unclassified	root	N/A	37.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.11 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	43.31 %
Unclassified	root	N/A	37.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.11 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	43.31 %
Unclassified	root	N/A	37.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.11 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	43.31 %
Unclassified	root	N/A	37.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.11 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.79 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	38.58 %
Unclassified	root	N/A	37.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.11 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.79 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.79 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38.58 %
Unclassified	root	N/A	37.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.11 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	0.79 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.79 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000176\|TB03JUN2009E_c002316	All Organisms → Viruses → Predicted Viral	4499	Open in IMG/M
3300000558\|Draft_10266308	All Organisms → Viruses → Predicted Viral	3025	Open in IMG/M
3300001239\|Draft_10328802	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1128	Open in IMG/M
3300001580\|Draft_10370534	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	597	Open in IMG/M
3300001605\|Draft_10263731	Not Available	980	Open in IMG/M
3300001605\|Draft_10326767	Not Available	837	Open in IMG/M
3300002408\|B570J29032_109841230	All Organisms → Viruses → Predicted Viral	1586	Open in IMG/M
3300003852\|Ga0031655_10307988	Not Available	591	Open in IMG/M
3300004240\|Ga0007787_10689759	Not Available	510	Open in IMG/M
3300004774\|Ga0007794_10183774	Not Available	624	Open in IMG/M
3300005077\|Ga0071116_1004276	Not Available	17835	Open in IMG/M
3300005581\|Ga0049081_10024193	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2306	Open in IMG/M
3300005581\|Ga0049081_10229764	Not Available	657	Open in IMG/M
3300005582\|Ga0049080_10024273	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2117	Open in IMG/M
3300005582\|Ga0049080_10030912	All Organisms → Viruses → Predicted Viral	1869	Open in IMG/M
3300005582\|Ga0049080_10172068	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	721	Open in IMG/M
3300005662\|Ga0078894_10332656	All Organisms → Viruses → Predicted Viral	1376	Open in IMG/M
3300005805\|Ga0079957_1003648	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13028	Open in IMG/M
3300005805\|Ga0079957_1054310	All Organisms → Viruses → Predicted Viral	2428	Open in IMG/M
3300005805\|Ga0079957_1093946	Not Available	1654	Open in IMG/M
3300005805\|Ga0079957_1195230	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	981	Open in IMG/M
3300006484\|Ga0070744_10027348	All Organisms → Viruses → Predicted Viral	1689	Open in IMG/M
3300006484\|Ga0070744_10091480	Not Available	880	Open in IMG/M
3300006484\|Ga0070744_10219282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	540	Open in IMG/M
3300006641\|Ga0075471_10113970	Not Available	1445	Open in IMG/M
3300006641\|Ga0075471_10170364	Not Available	1144	Open in IMG/M
3300006641\|Ga0075471_10178467	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1113	Open in IMG/M
3300006641\|Ga0075471_10250144	Not Available	911	Open in IMG/M
3300006802\|Ga0070749_10722529	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	531	Open in IMG/M
3300006805\|Ga0075464_10895450	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	554	Open in IMG/M
3300006875\|Ga0075473_10215560	Not Available	775	Open in IMG/M
3300006917\|Ga0075472_10504471	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	602	Open in IMG/M
3300007177\|Ga0102978_1063696	All Organisms → Viruses → Predicted Viral	1491	Open in IMG/M
3300007177\|Ga0102978_1350736	All Organisms → Viruses → Predicted Viral	1269	Open in IMG/M
3300007559\|Ga0102828_1029361	Not Available	1229	Open in IMG/M
3300008055\|Ga0108970_10551616	Not Available	11388	Open in IMG/M
3300008107\|Ga0114340_1000005	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	185548	Open in IMG/M
3300008962\|Ga0104242_1063054	Not Available	620	Open in IMG/M
3300009151\|Ga0114962_10013967	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5823	Open in IMG/M
3300009161\|Ga0114966_10099635	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1956	Open in IMG/M
3300009419\|Ga0114982_1103069	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	881	Open in IMG/M
3300010157\|Ga0114964_10004879	Not Available	8761	Open in IMG/M
3300010160\|Ga0114967_10018576	Not Available	4941	Open in IMG/M
3300010160\|Ga0114967_10351890	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	744	Open in IMG/M
3300010354\|Ga0129333_10007348	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10404	Open in IMG/M
3300010354\|Ga0129333_10284356	All Organisms → Viruses → Predicted Viral	1483	Open in IMG/M
3300010354\|Ga0129333_10722408	Not Available	855	Open in IMG/M
3300010354\|Ga0129333_11178926	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	637	Open in IMG/M
3300010354\|Ga0129333_11312359	Not Available	598	Open in IMG/M
3300010354\|Ga0129333_11651104	Not Available	522	Open in IMG/M
3300010388\|Ga0136551_1000183	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17784	Open in IMG/M
3300010388\|Ga0136551_1019725	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1318	Open in IMG/M
3300010885\|Ga0133913_10622721	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2831	Open in IMG/M
3300010885\|Ga0133913_13225156	All Organisms → Viruses → Predicted Viral	1077	Open in IMG/M
3300011268\|Ga0151620_1003476	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5874	Open in IMG/M
3300011268\|Ga0151620_1030972	All Organisms → Viruses → Predicted Viral	1824	Open in IMG/M
3300012347\|Ga0157142_1000002	Not Available	222825	Open in IMG/M
3300012352\|Ga0157138_1009480	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1608	Open in IMG/M
3300012664\|Ga0157497_1000001	Not Available	122614	Open in IMG/M
3300013004\|Ga0164293_10043191	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3672	Open in IMG/M
3300013005\|Ga0164292_10759959	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	615	Open in IMG/M
3300013285\|Ga0136642_1000016	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	117351	Open in IMG/M
3300013372\|Ga0177922_11048973	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	797	Open in IMG/M
3300014801\|Ga0119946_1010924	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	950	Open in IMG/M
3300018410\|Ga0181561_10278419	Not Available	786	Open in IMG/M
3300019122\|Ga0188839_1007692	All Organisms → Viruses → Predicted Viral	1340	Open in IMG/M
3300020048\|Ga0207193_1232930	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1413	Open in IMG/M
3300020141\|Ga0211732_1032034	All Organisms → Viruses → Predicted Viral	1296	Open in IMG/M
3300020160\|Ga0211733_10685849	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4477	Open in IMG/M
3300020161\|Ga0211726_10293882	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	912	Open in IMG/M
3300020172\|Ga0211729_10638684	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	702	Open in IMG/M
3300020172\|Ga0211729_11160203	Not Available	565	Open in IMG/M
3300020205\|Ga0211731_10375378	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	598	Open in IMG/M
3300020205\|Ga0211731_10488512	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	906	Open in IMG/M
3300020716\|Ga0214207_1005788	All Organisms → Viruses → Predicted Viral	1893	Open in IMG/M
3300021131\|Ga0214206_1009657	Not Available	1406	Open in IMG/M
3300021956\|Ga0213922_1054645	Not Available	878	Open in IMG/M
3300021961\|Ga0222714_10096081	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1888	Open in IMG/M
3300021961\|Ga0222714_10269788	Not Available	946	Open in IMG/M
3300021961\|Ga0222714_10423454	Not Available	698	Open in IMG/M
3300021961\|Ga0222714_10464327	Not Available	656	Open in IMG/M
3300021962\|Ga0222713_10414347	Not Available	826	Open in IMG/M
3300021962\|Ga0222713_10426236	Not Available	810	Open in IMG/M
3300021962\|Ga0222713_10479617	Not Available	748	Open in IMG/M
3300021963\|Ga0222712_10055323	All Organisms → Viruses → Predicted Viral	2937	Open in IMG/M
3300021963\|Ga0222712_10086266	All Organisms → Viruses → Predicted Viral	2229	Open in IMG/M
3300021963\|Ga0222712_10092357	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2136	Open in IMG/M
3300021963\|Ga0222712_10279189	All Organisms → Viruses → Predicted Viral	1056	Open in IMG/M
3300022752\|Ga0214917_10170326	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1118	Open in IMG/M
3300023174\|Ga0214921_10129352	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1785	Open in IMG/M
3300023174\|Ga0214921_10263424	Not Available	997	Open in IMG/M
3300023174\|Ga0214921_10471813	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	609	Open in IMG/M
3300024277\|Ga0255207_1003034	Not Available	3330	Open in IMG/M
3300024277\|Ga0255207_1016288	Not Available	1237	Open in IMG/M
3300024311\|Ga0255211_1023109	Not Available	1154	Open in IMG/M
3300024346\|Ga0244775_10003195	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	17517	Open in IMG/M
3300024346\|Ga0244775_10255661	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1459	Open in IMG/M
3300024346\|Ga0244775_10594619	Not Available	898	Open in IMG/M
3300024346\|Ga0244775_10890677	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	707	Open in IMG/M
3300024496\|Ga0255151_1044512	Not Available	737	Open in IMG/M
3300024509\|Ga0255175_1048610	Not Available	797	Open in IMG/M
3300024567\|Ga0256307_1021372	Not Available	1552	Open in IMG/M
3300025392\|Ga0208380_1059469	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	539	Open in IMG/M
3300025445\|Ga0208424_1005089	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1465	Open in IMG/M
3300025476\|Ga0208495_1017576	Not Available	1350	Open in IMG/M
3300025732\|Ga0208784_1088343	Not Available	932	Open in IMG/M
3300026402\|Ga0255304_1042721	Not Available	557	Open in IMG/M
3300027659\|Ga0208975_1171353	Not Available	595	Open in IMG/M
3300027710\|Ga0209599_10075740	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	883	Open in IMG/M
3300027749\|Ga0209084_1010003	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5806	Open in IMG/M
3300027770\|Ga0209086_10102369	All Organisms → Viruses → Predicted Viral	1464	Open in IMG/M
3300027785\|Ga0209246_10016333	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2769	Open in IMG/M
3300027805\|Ga0209229_10064635	All Organisms → Viruses → Predicted Viral	1638	Open in IMG/M
3300027805\|Ga0209229_10407806	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	589	Open in IMG/M
3300027836\|Ga0209230_10003851	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6299	Open in IMG/M
3300027896\|Ga0209777_10596081	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	800	Open in IMG/M
3300028083\|Ga0255190_1059125	Not Available	569	Open in IMG/M
3300031951\|Ga0315904_11116180	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	614	Open in IMG/M
3300033979\|Ga0334978_0004098	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	8093	Open in IMG/M
3300033993\|Ga0334994_0352329	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	728	Open in IMG/M
3300034022\|Ga0335005_0198888	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1244	Open in IMG/M
3300034022\|Ga0335005_0213823	All Organisms → Viruses → Predicted Viral	1189	Open in IMG/M
3300034050\|Ga0335023_0013528	All Organisms → Viruses → Predicted Viral	4776	Open in IMG/M
3300034066\|Ga0335019_0820985	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	523	Open in IMG/M
3300034082\|Ga0335020_0062910	Not Available	1930	Open in IMG/M
3300034093\|Ga0335012_0409724	Not Available	661	Open in IMG/M
3300034116\|Ga0335068_0201586	All Organisms → Viruses → Predicted Viral	1043	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	95.28%
Engineered	Engineered	3.94%
Host-Associated	Host-Associated	0.79%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	93.70%
Wastewater	Engineered → Wastewater	3.94%
Terrestrial	Environmental → Terrestrial	1.57%
Plants	Host-Associated → Plants	0.79%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	65.35%
Marine	Environmental → Aquatic → Marine	28.35%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	3.94%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.57%
Leaf	Host-Associated → Plants → Leaf	0.79%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	33.07%
Lentic	Environmental → Aquatic → Freshwater → Lentic	17.32%
Unclassified	Environmental → Aquatic → Marine → Unclassified	14.17%
Coastal	Environmental → Aquatic → Marine → Coastal	12.60%
River	Environmental → Aquatic → Freshwater → River	6.30%
Lotic	Environmental → Aquatic → Freshwater → Lotic	3.94%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	3.94%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	1.57%
Pond	Environmental → Aquatic → Freshwater → Pond	1.57%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.57%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.57%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.79%
Creek	Environmental → Aquatic → Freshwater → Creek	0.79%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	32.28%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	14.17%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	13.39%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	12.60%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	6.30%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	3.94%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	3.94%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.36%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.57%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	1.57%
Unclassified	Environmental → Aquatic → Freshwater → Pond → Unclassified	1.57%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.57%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.79%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	0.79%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.79%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.79%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.79%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.79%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	11.81%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	8.66%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	7.87%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	7.87%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	7.09%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	6.30%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	5.51%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	4.72%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	4.72%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	3.15%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	3.15%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	3.15%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	3.94%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.36%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	2.36%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	2.36%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.57%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.57%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	1.57%
Pond Fresh Water	Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water	1.57%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.57%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	0.79%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.79%
Aquatic	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic	0.79%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.79%
Sinkhole	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole	0.79%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.79%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.79%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.79%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.79%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000176	Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion	Environmental	Open in IMG/M
3300000558	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011	Engineered	Open in IMG/M
3300001239	Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin	Engineered	Open in IMG/M
3300001580	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6	Engineered	Open in IMG/M
3300001605	Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin	Engineered	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300003852	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB	Environmental	Open in IMG/M
3300004240	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN	Environmental	Open in IMG/M
3300004774	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M	Environmental	Open in IMG/M
3300005077	Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006641	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006875	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA	Environmental	Open in IMG/M
3300006917	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA	Environmental	Open in IMG/M
3300007177	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008962	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010388	Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011268	Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555	Environmental	Open in IMG/M
3300012347	Freshwater microbial communities from Fish Creek, Ontario, Canada - S48	Environmental	Open in IMG/M
3300012352	Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37	Environmental	Open in IMG/M
3300012664	Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013285	Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014801	Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW	Environmental	Open in IMG/M
3300018410	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)	Environmental	Open in IMG/M
3300019122	Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020716	Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion	Environmental	Open in IMG/M
3300021131	Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion	Environmental	Open in IMG/M
3300021956	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024277	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d	Environmental	Open in IMG/M
3300024311	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8d	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024496	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h	Environmental	Open in IMG/M
3300024509	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d	Environmental	Open in IMG/M
3300024567	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025392	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)	Environmental	Open in IMG/M
3300025445	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025476	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M (SPAdes)	Environmental	Open in IMG/M
3300025732	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300026402	Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027770	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027836	Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)	Environmental	Open in IMG/M
3300027896	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)	Environmental	Open in IMG/M
3300028083	Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300033979	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300034022	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058	Environmental	Open in IMG/M
3300034050	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034116	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
TB03JUN2009E_00231611	3300000176	Freshwater	MNEDERAGWWAVVCLLMVGAAAYFTIFMIVFSLLKHFFGVE*
Draft_102663083	3300000558	Hydrocarbon Resource Environments	VNEGERAGLWAVAYLLIVGVTAYFTIFMIIFSIIKTLVGVE*
Draft_103288023	3300001239	Hydrocarbon Resource Environments	MNEGGRAGLWAVAYLLIVGVTAYFTIFMIIFSIIKTLVGVE*
Draft_103705342	3300001580	Hydrocarbon Resource Environments	MTEGERAGWWAVAYLLIVGAAAYFTIFMVVFSFIKQYLGD*
Draft_102637312	3300001605	Hydrocarbon Resource Environments	MTEGDRAGWWAIVYLLMVGAAAYFTMFVLIFSFVRQLFWN*
Draft_103267674	3300001605	Hydrocarbon Resource Environments	MNEGEKSAVWVTVCLLMVGTAAYFTIFMIIFNFVKQLFWS*
B570J29032_1098412307	3300002408	Freshwater	MTDGDRAGWWAVVYLLMVGAAAYFTMFMVIFSFIKQMFWS*
Ga0031655_103079882	3300003852	Freshwater Lake Sediment	MTSGDRAGWWAIAYLLMVGAAAYFTIFMIVFSFVKKLFWS*
Ga0007787_106897591	3300004240	Freshwater Lake	MNEGERAGWWAVAYLLIVGAAAYFTIFMIIFSFAKKLFWS*
Ga0007794_101837742	3300004774	Freshwater	MNEGEQAGRWAIVYLLMVGAAAYFSIVMIVFSFVKKLFWS*
Ga0071116_10042766	3300005077	Sinkhole	MNEGERAGWWAVVYLLMVGAAAYFTIFMIIFSFVKKLFLELK*
Ga0049081_100241937	3300005581	Freshwater Lentic	MSPGDRAGWWAVVLLLMLGATAYFNIFMIVFSFLGVKP*
Ga0049081_102297642	3300005581	Freshwater Lentic	MTEGERAGLWAVVYLLMVGAAAYFTMFMIIFSFVKKLFWS*
Ga0049080_100242735	3300005582	Freshwater Lentic	MSEGDRAGWWAVVLLLMLGATAYFSIFMIVFSFLRS*
Ga0049080_100309122	3300005582	Freshwater Lentic	MTEGERAGRWAIVFLLMVGAAGYFTIFMIIFSFVKKLFWS*
Ga0049080_101720681	3300005582	Freshwater Lentic	MNEGDRAGWWAVAILLMVGAAVYFTIFMIVFSFVKETFRS*
Ga0078894_103326566	3300005662	Freshwater Lake	MSSGDRAGWWAVVYLLMIGAAAYFTIFMIIFSFIRKLFWS*
Ga0079957_10036484	3300005805	Lake	MTDGERAGWWAVVYLLMVGVAAYFTMFMVIFSFIKQMFWS*
Ga0079957_10543103	3300005805	Lake	MSPADRAGVWAIVYLLITGATAYFTIFMIVVSFIRQQFWS*
Ga0079957_10939463	3300005805	Lake	MTEGDRAGLWAIVYLLLLGAAAYFTIFMVIFSFLRQIFWS*
Ga0079957_11952303	3300005805	Lake	MTDGDRAGWWAIAYLLMVGAAAYFTMFMVIFSFIKQYLGD*
Ga0070744_100273481	3300006484	Estuarine	MSEGDRAGWWAIVYLLMVGAAAYFTIFMIIFSFVKKLFWS*
Ga0070744_100914803	3300006484	Estuarine	MSEGDRAGWWAIVYLLMLGVTAYFSIFMIIFSFVKKLFWS*
Ga0070744_102192822	3300006484	Estuarine	MNQRMSEGDRAGWWAIIYLLMVGAAAYFTIFMIIFSFVKKLFWS*
Ga0075471_101139705	3300006641	Aqueous	MTDGDKAGWWAMAYLLMVGAAAYFTIFMVIFSFIKQMFWS*
Ga0075471_101703645	3300006641	Aqueous	MTEGERAGRWAVALLLLVGVAAYFTIFMVIFSFVKQYLGD*
Ga0075471_101784675	3300006641	Aqueous	MTEGDRAGWWAVVYLLMVGVAAYFTMFMVIFSFVKQYLGD*
Ga0075471_102501444	3300006641	Aqueous	MTEGERAGRWAVALLLMVGAAAYFTMFMVIFSFIKQYLGD*
Ga0070749_107225292	3300006802	Aqueous	MTEGERAGWWAIVYLLIVGAAAYFTIFAVIFSFLKQMCWS*
Ga0075464_108954501	3300006805	Aqueous	AGWWAVAYLLMVGAAAYFTIFMIVFSFVKKLFWS*
Ga0075473_102155603	3300006875	Aqueous	MTEGERAGWLAVVYLLMVGAAAYFTIFMVIFSFVKQYLGD*
Ga0075472_105044712	3300006917	Aqueous	MSEGARAGWWAVAYLLIVGAAAYFTIFMIVFSFVKKLFWS*
Ga0102978_10636961	3300007177	Freshwater Lake	MTDGDKAGWWAVVYLLMVGAAAYFTMFMVIFSFLKQTFWS*
Ga0102978_13507364	3300007177	Freshwater Lake	MTEGDKAGWWAIVYLLMVGAAAYFTMFTIVISFFEKLFWS*
Ga0102828_10293612	3300007559	Estuarine	MSEGEQAGWWAVAYLLIVGAAAYFSIFMIVFSFVKKLFWS*
Ga0108970_1055161611	3300008055	Estuary	MSEADRAGWRAVAYLLMMGAAAYFTIVMIIFSFVKKLFWS*
Ga0114340_1000005210	3300008107	Freshwater, Plankton	MNEGERAGCWAIVYLLMIGATAYFTIFMIVFSFVKKLFWS*
Ga0104242_10630542	3300008962	Freshwater	MTEGDRAGLWAIAYLLLVGAAAYFTIFMVVFSFVKKLIWN*
Ga0114962_100139676	3300009151	Freshwater Lake	MNEGEQAGRRAIVYLLMMGAAAYFTIVMIIFSFVKDIFWS*
Ga0114966_100996355	3300009161	Freshwater Lake	MMTEGEQAGRWAIVYLLMAGAAAYFTIVMIVFSFVKDIFWS*
Ga0114982_11030692	3300009419	Deep Subsurface	MSEGERAGRYAIVYLLIVGAAAYFTIFMIIFSFVKKLFWS*
Ga0114964_100048792	3300010157	Freshwater Lake	MMNEGEQAGRWAIVYLLMVGAAAYFSIVMIVFSFVKKLFWS*
Ga0114967_1001857612	3300010160	Freshwater Lake	MSEADRAGWWAIVYLLMVGAAAYFTIFMIAFSFVKKLFWS*
Ga0114967_103518901	3300010160	Freshwater Lake	MMTEGEQAGRWAIVYLLMAGAAAYFTIVMIIFSFVKDKFRS*
Ga0129333_1000734811	3300010354	Freshwater To Marine Saline Gradient	MSEGDRAGVWVVVYLLMVGAAAYFTIFMVIFSFLIK*
Ga0129333_102843564	3300010354	Freshwater To Marine Saline Gradient	MTEADRAGWWAVVYLLMVGAAAYFTIFMVIFSFVKKLFWS*
Ga0129333_107224084	3300010354	Freshwater To Marine Saline Gradient	MTDGDRAGRWAVALLLLVGVAAYFTIFMVIFSFVKQYLGD*
Ga0129333_111789262	3300010354	Freshwater To Marine Saline Gradient	MNEGDRAGWWAIVYLLMVGAAAYFTMFMVIFSFIKRMFWS*
Ga0129333_113123592	3300010354	Freshwater To Marine Saline Gradient	MTEGDRAGWWAVVYLLMVGVAAYFTMFMVIFSFIKQMFWS*
Ga0129333_116511042	3300010354	Freshwater To Marine Saline Gradient	MTDGDRAGWWAVVYLLMVGAAAYFTMFIVIFSFIKQYLGD*
Ga0136551_100018326	3300010388	Pond Fresh Water	MTEGDRAGVWAIVYLLMVGAAAYFTIFMIIFSFVKKLFWS*
Ga0136551_10197253	3300010388	Pond Fresh Water	MTEGEKAGWWAIVYLLMVGAAAYFTIFMVIFSFIKRLFWS*
Ga0133913_106227218	3300010885	Freshwater Lake	MTEGEQAGRWAIVYLLMAGAAAYFTIVMIVFSFVKDIFWS*
Ga0133913_132251562	3300010885	Freshwater Lake	MSEGDRAGWRAVVYLLMAGAAAYFTIFMIVFSFVKDTFWS*
Ga0151620_10034763	3300011268	Freshwater	MNEGERAGWWALAYLLMVGAAAYFTMFMVVFSFIKQYLGD*
Ga0151620_10309724	3300011268	Freshwater	MTEGDRAGWWAVVYLLMVGAAAYFTMFMIVFSFVKKLFWS*
Ga0157142_1000002180	3300012347	Freshwater	MSEGDRAGVWAIVYLLMVGAAAYFTIFMIMFSFVRKMFWG*
Ga0157138_10094803	3300012352	Freshwater	MTEGDRAGVWAIVYLLMVGAAAYFTMFMVIFSFVKELFRG*
Ga0157497_100000115	3300012664	Freshwater	MSEGDRAGVWAIVYLLMVGAAAYFTIFMIAFSFVRKMFWG*
Ga0164293_100431919	3300013004	Freshwater	MTEGERAGWWAVVYLLMAGAAAYFTIFMIIFSYVKKLFWS*
Ga0164292_107599592	3300013005	Freshwater	MTEGDQAGWRAVILLLIVGAAAYFTIVMIIFSFIKKLFWS*
Ga0136642_1000016128	3300013285	Freshwater	MSEVDRAGWWAVVYLLMIGATAYFTIFMIVFGFVKKLFWS*
Ga0177922_110489732	3300013372	Freshwater	MNEGDRAGWWAVAILLMVGAAVYFTIFMIVFSFVKETFWS*
Ga0119946_10109243	3300014801	Aquatic	MMSGEKAGWWAIVYLLMVGAAAYFTMFMVIFSFIKRMVWS*
Ga0181561_102784193	3300018410	Salt Marsh	MTEGERAGWWAVAYLLLVGAAAYFTIFMVIFSFVKQTF
Ga0188839_10076922	3300019122	Freshwater Lake	MTEGDRAGWWAIVYLLMVGAAAYFTMFMIIFSFVKKLFWS
Ga0207193_12329306	3300020048	Freshwater Lake Sediment	MTDGDRAGWWAVVYLLMVGAAAYFTIFMVIFSLLNNI
Ga0211732_10320344	3300020141	Freshwater	MNEGERAGWWAIVYLLMVGAAAYFTMFMIIFSFVKKLFWS
Ga0211733_1068584914	3300020160	Freshwater	MTEGDRAGWWAVVLLVMLGATAYFTIFMIVFSFLRS
Ga0211726_102938825	3300020161	Freshwater	MTEGERAGWWAVVYLLMVGAAAYFTMFMIIFSFVKKLFWS
Ga0211729_106386843	3300020172	Freshwater	MTEGDRAGWWAVVYLLMVGAAAYFTMFMIIFSFVKKLFWS
Ga0211729_111602031	3300020172	Freshwater	MTEGERAGRWAIVLLLIVGAAAYFTMFMIIFSFVKKLFWS
Ga0211731_103753783	3300020205	Freshwater	MSEGDRAGWWAVVYLLMVGAAAYFTIIMVIFSFVKKLFWS
Ga0211731_104885123	3300020205	Freshwater	MTEGERAGRWAIVYLLIVGAAAYFTMFMIIFSFVKKLFWS
Ga0214207_10057885	3300020716	Freshwater	MNEDERAGWWAVVCLLMVGAAAYFTIFMIVFSLLKHFFGVE
Ga0214206_10096573	3300021131	Freshwater	MTSGDQAGWWAIAYLLMVGAAAYFTIFMIVFSFVKKLFWS
Ga0213922_10546454	3300021956	Freshwater	MTDGERAGWWAVAYLLMVGAAAYFTIFMIVFSFVKKLF
Ga0222714_100960812	3300021961	Estuarine Water	MTEGDRAGWWAVVYLLMVGAAAYFTIFMIVFSFVKKMFWS
Ga0222714_102697882	3300021961	Estuarine Water	MNEGERAGWWAVVYLLMVGAAVYFTIFAIVFSFVKKWVWG
Ga0222714_104234541	3300021961	Estuarine Water	MNEGERAGWWALAYLLMVGAAAYFTMFMVVFSFIKQYLGD
Ga0222714_104643273	3300021961	Estuarine Water	MTEGDRAGWWAIAYLLLVGAAAYFTIFMVVFSFVKKLIWS
Ga0222713_104143473	3300021962	Estuarine Water	MTEGDRAGWWAVAYLLMVGAAAYFTIFMIAFSFVKKLWS
Ga0222713_104262363	3300021962	Estuarine Water	MSEGDRAGWWAVVYLLMVGAAAYFTIFMIVFSFVKKLFWS
Ga0222713_104796172	3300021962	Estuarine Water	MTEGERAGVWAIVYLLMVGAAAYFTIFAIAFSFVKQLFWS
Ga0222712_1005532311	3300021963	Estuarine Water	MTEGEKAGWWAIAYLLMVGAAAYFTMFMIVFSFLKRLFWS
Ga0222712_100862669	3300021963	Estuarine Water	MTEGDRAGWWAVVYLLMVGAAAYFTMFMIVFSFVKKLFWS
Ga0222712_100923572	3300021963	Estuarine Water	MTDGDRAGWWAVALLLMVGAAAYFTMFMVIFSFIKQYLGD
Ga0222712_102791893	3300021963	Estuarine Water	MSEGERAGWWAVAYLLMVGAAAYFTIFMIVFSFVKKLFWS
Ga0214917_101703265	3300022752	Freshwater	MNEGERAGWWAVVYLLMVGAAAYFTIFMIVFSFVKTFFFGVE
Ga0214921_101293523	3300023174	Freshwater	MTEGDRAGWWAIVYLLLVGAAAYFTIFMVVFSFVKKLIWG
Ga0214921_102634245	3300023174	Freshwater	MTEGDRAGLWAIAYLLLVGAAAYFTIFMVVFSFVKKLIWG
Ga0214921_104718132	3300023174	Freshwater	MTEGEKAGWWAIVYLLLVGAAAYFTIFMVVFSFVKKLIWS
Ga0255207_10030343	3300024277	Freshwater	MTEGERAGRWAVALLLLVGVAAYFTIFMVIFSFVKQYLGD
Ga0255207_10162886	3300024277	Freshwater	MTDGDKAGWWAMAYLLMVGAAAYFTIFMVIFSFIKQMFWS
Ga0255211_10231096	3300024311	Freshwater	MTDGDKAGWWAMAYLLMVGAAAYFTIFMVIFSFIKQMF
Ga0244775_1000319520	3300024346	Estuarine	MSEGDRAGWWAIVYLLMVGAAAYFTIFMIIFSFVKKLFWS
Ga0244775_102556613	3300024346	Estuarine	MSEGDRAGVWAVAYLLMVGAAAYFTIVMIVFSFVKKLFWS
Ga0244775_105946193	3300024346	Estuarine	MSEGDRAGWWAIVYLLMLGVTAYFSIFMIIFSFVKKLFWS
Ga0244775_108906773	3300024346	Estuarine	MSEGDRAGWRAVVYLLMAGAAAYFTIFMIVFSFVKDTFWS
Ga0255151_10445121	3300024496	Freshwater	MNEGERAGWWALAYLLMVGAAAYFTMFMVVFSFIKQ
Ga0255175_10486101	3300024509	Freshwater	MTEGERAGWWAIAYILMVGASAYFTIFMIAFCFVKKMFWS
Ga0256307_10213726	3300024567	Freshwater	MTSGDRAGWWAIAYLLMVGAAAYFTIFMIVFSFVKKLIWG
Ga0208380_10594692	3300025392	Freshwater	MTSGDRAGWWAIAYLLMVGAAAYFTIFMIVFSFVKKLFWS
Ga0208424_10050895	3300025445	Aqueous	MTEGERAGWWAIVYLLIVGAAAYFTIFAVIFSFLKQMCWS
Ga0208495_10175761	3300025476	Freshwater	MNEGEQAGRWAIVYLLMVGAAAYFSIVMIVFSFVKKLFWS
Ga0208784_10883432	3300025732	Aqueous	MTEGERAGRWAVALLLMVGAAAYFTMFMVIFSFIKQYLGD
Ga0255304_10427213	3300026402	Freshwater	MTEGERAGWLAVVYLLMVGVAAYFTIFMVIFSFVKQYLGD
Ga0208975_11713532	3300027659	Freshwater Lentic	MTEGERAGLWAVVYLLMVGAAAYFTMFMIIFSFVKKLFWS
Ga0209599_100757402	3300027710	Deep Subsurface	MSEGERAGRYAIVYLLIVGAAAYFTIFMIIFSFVKKLFWS
Ga0209084_101000313	3300027749	Freshwater Lake	MNEGEQAGRRAIVYLLMMGAAAYFTIVMIIFSFVKDIFWS
Ga0209086_101023693	3300027770	Freshwater Lake	MTEGEQAGRWAIVYLLMAGAAAYFTIVMIVFSFVKDIFWS
Ga0209246_100163336	3300027785	Freshwater Lake	MTEGDRAGWWAVVPLLIVGAAAYFTIFMIIFSFVKKLFWS
Ga0209229_100646353	3300027805	Freshwater And Sediment	EGDRAGWWAVVYLLMVGAAAYFTMFMIIFSFVKKLFWS
Ga0209229_104078061	3300027805	Freshwater And Sediment	MSEGERAGVWAIVYLLMVGVAAYFTMFMIIFSFVKKLFWS
Ga0209230_1000385110	3300027836	Freshwater And Sediment	MSEGDRAGWWAVVYLLMIGAAAYFTIFMIIFSFVKKLFWS
Ga0209777_105960813	3300027896	Freshwater Lake Sediment	MNEGERAGWWAVVCLLMVGAAAYFTIFMIVFSLLKHFFGVE
Ga0255190_10591251	3300028083	Freshwater	TMTEGERAGRWAVALLLLVGVAAYFTIFMVIFSFVKQYLGD
Ga0315904_111161801	3300031951	Freshwater	MTDGERAGRWAVALLLMVGAAAYFTMFMVIFSFIKQYLGD
Ga0334978_0004098_367_489	3300033979	Freshwater	MTDGDRAGWWAVVYLLMVGAAAYFTMFMVIFSFIKQMFWS
Ga0334994_0352329_490_612	3300033993	Freshwater	MNEGERAGWWAVVYLLMAGAAAYFTIFMIIFSYVKKLFWS
Ga0335005_0198888_111_233	3300034022	Freshwater	MNEGERAGWWAVVYLLMAGAAAYFTIVMIIFSFIRKLFWS
Ga0335005_0213823_1009_1131	3300034022	Freshwater	MTEGDRAGWWAVVYLLMAGAAAYFTIFMIIFSYVKKLFWS
Ga0335023_0013528_4295_4429	3300034050	Freshwater	MNQRMSEGDRAGWWAVVYLLMVGAAAYFTIIMVIFSFVKKLFWS
Ga0335019_0820985_191_307	3300034066	Freshwater	MTEGERAGRWAIVYLLIVGATAYFTIFMIIFSFVRQLF
Ga0335020_0062910_334_456	3300034082	Freshwater	MTEGDRAGWWAIVYLLMLGVTAYFSIFMIIFSFVKKLFWS
Ga0335012_0409724_88_210	3300034093	Freshwater	MNQGERAGWWAVAYLLLIGAAAYFTIFMLFFSFVKDTFWS
Ga0335068_0201586_284_406	3300034116	Freshwater	MNEGERAGWWAVVYLLMVGATAYFTIVMIIFSFIRKLFWS

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F065781

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences