NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065834

Metagenome / Metatranscriptome Family F065834

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065834
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 48 residues
Representative Sequence MKRKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMSGY
Number of Associated Samples 109
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 9.45 %
% of genes near scaffold ends (potentially truncated) 47.24 %
% of genes from short scaffolds (< 2000 bps) 69.29 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.213 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(7.874 % of family members)
Environment Ontology (ENVO) Unclassified
(37.008 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.031 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 28.00%    β-sheet: 0.00%    Coil/Unstructured: 72.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF13528Glyco_trans_1_3 18.11
PF00155Aminotran_1_2 10.24
PF13715CarbopepD_reg_2 6.30
PF13620CarboxypepD_reg 5.51
PF04101Glyco_tran_28_C 4.72
PF14905OMP_b-brl_3 3.94
PF00300His_Phos_1 1.57
PF00406ADK 1.57
PF00781DAGK_cat 0.79
PF05193Peptidase_M16_C 0.79
PF01641SelR 0.79
PF10604Polyketide_cyc2 0.79
PF00378ECH_1 0.79
PF00005ABC_tran 0.79
PF15902Sortilin-Vps10 0.79
PF00355Rieske 0.79
PF00892EamA 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 1.57
COG1597Phosphatidylglycerol kinase, diacylglycerol kinase familyLipid transport and metabolism [I] 1.57
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.21 %
UnclassifiedrootN/A0.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_126854All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes598Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0851338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9127Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2273709All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium868Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101881135All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2840Open in IMG/M
3300000893|AP72_2010_repI_A001DRAFT_1004941All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2571Open in IMG/M
3300000955|JGI1027J12803_103399398All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes936Open in IMG/M
3300001977|JGI24746J21847_1071035All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae507Open in IMG/M
3300002090|JGI24806J26614_1001609All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis7965Open in IMG/M
3300002100|JGI24809J26612_1013023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1645Open in IMG/M
3300002100|JGI24809J26612_1018305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1258Open in IMG/M
3300002906|JGI25614J43888_10038412All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1492Open in IMG/M
3300003453|ERB_1007678All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea7174Open in IMG/M
3300003465|P52013CM_1064088All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea814Open in IMG/M
3300004009|Ga0055437_10194322All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae647Open in IMG/M
3300004157|Ga0062590_100843607All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae849Open in IMG/M
3300004463|Ga0063356_100354577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1857Open in IMG/M
3300004778|Ga0062383_10000755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea8693Open in IMG/M
3300004782|Ga0062382_10512213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae578Open in IMG/M
3300004808|Ga0062381_10040372All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1287Open in IMG/M
3300005093|Ga0062594_100044996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea2199Open in IMG/M
3300005180|Ga0066685_10531753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea812Open in IMG/M
3300005183|Ga0068993_10004781All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea2688Open in IMG/M
3300005184|Ga0066671_10760688All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea622Open in IMG/M
3300005293|Ga0065715_10583666All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae718Open in IMG/M
3300005329|Ga0070683_100006531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea9793Open in IMG/M
3300005329|Ga0070683_100130712All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea2376Open in IMG/M
3300005329|Ga0070683_102285182All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea519Open in IMG/M
3300005331|Ga0070670_100088604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2660Open in IMG/M
3300005336|Ga0070680_102013647All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae500Open in IMG/M
3300005337|Ga0070682_101231114All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes633Open in IMG/M
3300005347|Ga0070668_100471154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1083Open in IMG/M
3300005355|Ga0070671_100314733All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1334Open in IMG/M
3300005356|Ga0070674_101378046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae631Open in IMG/M
3300005364|Ga0070673_101880099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea567Open in IMG/M
3300005367|Ga0070667_100160779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1978Open in IMG/M
3300005441|Ga0070700_100594703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae866Open in IMG/M
3300005441|Ga0070700_100736652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae787Open in IMG/M
3300005457|Ga0070662_100631454All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae902Open in IMG/M
3300005543|Ga0070672_100817247All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae821Open in IMG/M
3300005657|Ga0073903_10134541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1144Open in IMG/M
3300005659|Ga0073900_10006824All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea5580Open in IMG/M
3300005659|Ga0073900_10247136All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae806Open in IMG/M
3300005719|Ga0068861_100784584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea893Open in IMG/M
3300005719|Ga0068861_101803706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea607Open in IMG/M
3300005831|Ga0074471_10513055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella3360Open in IMG/M
3300005833|Ga0074472_10511677All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1870Open in IMG/M
3300005834|Ga0068851_10507067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae724Open in IMG/M
3300005836|Ga0074470_11206772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2119Open in IMG/M
3300005841|Ga0068863_100565761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1123Open in IMG/M
3300005842|Ga0068858_100380645All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1354Open in IMG/M
3300005844|Ga0068862_100607061All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1051Open in IMG/M
3300005985|Ga0081539_10043285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2612Open in IMG/M
3300006046|Ga0066652_100338907All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1349Open in IMG/M
3300006056|Ga0075163_10299841All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1828Open in IMG/M
3300006358|Ga0068871_100040664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea3725Open in IMG/M
3300006854|Ga0075425_100258396All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2004Open in IMG/M
3300006871|Ga0075434_101937393All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae595Open in IMG/M
3300006871|Ga0075434_102661342All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae500Open in IMG/M
3300007004|Ga0079218_10034721All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea2970Open in IMG/M
3300007004|Ga0079218_12650584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea597Open in IMG/M
3300009095|Ga0079224_100197164All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea2904Open in IMG/M
3300010154|Ga0127503_11296817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes650Open in IMG/M
3300010364|Ga0134066_10167665All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes703Open in IMG/M
3300010400|Ga0134122_10082175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2523Open in IMG/M
3300010937|Ga0137776_1811047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1602Open in IMG/M
3300011119|Ga0105246_11138641All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes715Open in IMG/M
3300011119|Ga0105246_12579016All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes502Open in IMG/M
3300011444|Ga0137463_1000941All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9648Open in IMG/M
3300012202|Ga0137363_11012369All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium706Open in IMG/M
3300012204|Ga0137374_10992460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae608Open in IMG/M
3300012212|Ga0150985_100148872All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes509Open in IMG/M
3300012212|Ga0150985_102991782Not Available551Open in IMG/M
3300012212|Ga0150985_105644275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes885Open in IMG/M
3300012212|Ga0150985_109861179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp.559Open in IMG/M
3300012362|Ga0137361_11454019All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes608Open in IMG/M
3300012469|Ga0150984_123365828All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea842Open in IMG/M
3300012930|Ga0137407_10248874All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1610Open in IMG/M
3300012948|Ga0126375_10538381All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes879Open in IMG/M
3300012957|Ga0164303_10181523All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1147Open in IMG/M
3300012958|Ga0164299_10416173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes868Open in IMG/M
3300012960|Ga0164301_10919996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes680Open in IMG/M
3300012984|Ga0164309_11234439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes629Open in IMG/M
3300012985|Ga0164308_10629497All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes916Open in IMG/M
3300013297|Ga0157378_11896017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes645Open in IMG/M
3300013307|Ga0157372_12261191All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes625Open in IMG/M
3300015372|Ga0132256_100031234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4823Open in IMG/M
3300015373|Ga0132257_102291650All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae700Open in IMG/M
3300015374|Ga0132255_100053920All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter ginsengisoli5253Open in IMG/M
3300017695|Ga0180121_10294755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes615Open in IMG/M
3300017789|Ga0136617_11065684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes611Open in IMG/M
3300017927|Ga0187824_10009519All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea2773Open in IMG/M
3300017927|Ga0187824_10038172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1461Open in IMG/M
3300018059|Ga0184615_10081301All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1816Open in IMG/M
3300018068|Ga0184636_1322761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes541Open in IMG/M
3300018429|Ga0190272_10124541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1716Open in IMG/M
3300018429|Ga0190272_12373974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes574Open in IMG/M
3300018476|Ga0190274_10004983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea7970Open in IMG/M
3300018476|Ga0190274_10032485All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3583Open in IMG/M
3300019487|Ga0187893_10004319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes27253Open in IMG/M
3300021478|Ga0210402_10575213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1045Open in IMG/M
3300023092|Ga0247740_1001281All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae10916Open in IMG/M
3300023272|Ga0247760_1051825All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1048Open in IMG/M
3300025900|Ga0207710_10010870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3833Open in IMG/M
3300025920|Ga0207649_10648620All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes815Open in IMG/M
3300025923|Ga0207681_10785435All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes795Open in IMG/M
3300025931|Ga0207644_11793589All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes513Open in IMG/M
3300025933|Ga0207706_10142875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2105Open in IMG/M
3300025938|Ga0207704_11762067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes532Open in IMG/M
3300025942|Ga0207689_10012916All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7131Open in IMG/M
3300025961|Ga0207712_11760129All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes555Open in IMG/M
3300025986|Ga0207658_10291569All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1402Open in IMG/M
3300026023|Ga0207677_10020186All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4040Open in IMG/M
3300026088|Ga0207641_10055600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea3361Open in IMG/M
3300026095|Ga0207676_11082901All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300027694|Ga0209170_1007617All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4262Open in IMG/M
3300027831|Ga0209797_10003224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus8123Open in IMG/M
3300027831|Ga0209797_10012989All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea3866Open in IMG/M
3300027840|Ga0209683_10001595All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8679Open in IMG/M
3300027886|Ga0209486_10901436All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes586Open in IMG/M
3300028025|Ga0247723_1124886All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium625Open in IMG/M
3300029239|Ga0168092_1000936All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes11819Open in IMG/M
3300032004|Ga0307414_10245010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1486Open in IMG/M
3300032004|Ga0307414_10255637All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus1459Open in IMG/M
3300032012|Ga0310902_10004887All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB25066Open in IMG/M
3300032143|Ga0315292_10516674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1006Open in IMG/M
3300033412|Ga0310810_10757525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes888Open in IMG/M
3300034197|Ga0370508_0262203All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium567Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.51%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.15%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.15%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere3.15%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge3.15%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.94%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)2.36%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.36%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.36%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.57%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.57%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.57%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.57%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.57%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.79%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.79%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.79%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.79%
Ore Pile And Mine Drainage Contaminated SoilEnvironmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil0.79%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.79%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.79%
Volcano-Associated FumaroleEnvironmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole0.79%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.79%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.79%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.79%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.79%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.79%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.79%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000893Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001977Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5Host-AssociatedOpen in IMG/M
3300002090Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDAEnvironmentalOpen in IMG/M
3300002100Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDAEnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300003453Combined Assembly of Gp0111477, Gp0111476EnvironmentalOpen in IMG/M
3300003465Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sampleEnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005657Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulkEngineeredOpen in IMG/M
3300005659Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-KitEngineeredOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300023092Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L148-409B-2EnvironmentalOpen in IMG/M
3300023272Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027694Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk (SPAdes)EngineeredOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300029239Activated sludge microbial communities from sewage treatment plant in Sweden - SWESTP22 - Henriksdal-surplus 129EngineeredOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034197Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02S_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_020372802199352025SoilMKQNNKILVLLLLLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGMT
ICChiseqgaiiDRAFT_0851338133300000033SoilMQFMTRKNNIWLLMLLFVILATACNRNYYSGNGKGSNCGCPSKKGMVGY*
ICChiseqgaiiDRAFT_227370933300000033SoilMKNINKIALLLVFVATVVFAGCNKNYYSGNGKGGKNCGCPSVKQ*
INPhiseqgaiiFebDRAFT_10188113543300000364SoilMKQNNKILVLLLLLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGMTGD*
AP72_2010_repI_A001DRAFT_100494133300000893Forest SoilMKQKSKIIVLLLMLGIIVASCNKNYYSGTGKGSNCGCPSHKGMVGY*
JGI1027J12803_10339939813300000955SoilMRRKNNILILLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMV
JGI24746J21847_107103513300001977Corn, Switchgrass And Miscanthus RhizosphereMKNIRKMSLLLLLAGVIVLSACNRNYYSGTGKGSSCGCPSHKG
JGI24806J26614_100160973300002090SoilMKRKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMSGY*
JGI24809J26612_101302323300002100SoilMNRKNKILALLLLLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGMSGY*
JGI24809J26612_101830523300002100SoilMNRKNKILALLLLLGTIVAFGCNKNYYSGTGKGSSCGCPSHKGMSGF*
JGI25614J43888_1003841213300002906Grasslands SoilFKEPGGQIMKTINKIALLLLVAGILLVTGCNRNYYSGTGKGSNCGCPSHKGMSGY*
ERB_100767863300003453Volcano-Associated FumaroleMMKKNKIVLLVLLIGTILATACNKNYYSGNGKGGGNCGCPSHKGMTGY*
P52013CM_106408823300003465Ore Pile And Mine Drainage Contaminated SoilMKNNQKLTLLLLLAGMIFLAACNRNYYSGTGKGSNCGCPSHKGMSGY*
Ga0055437_1019432223300004009Natural And Restored WetlandsMKTINKIALIVLVAGILVVAGCSRNYYSGTGKGSNCGCPSHKGMVGY
Ga0062590_10084360733300004157SoilMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0063356_10035457713300004463Arabidopsis Thaliana RhizosphereMKNINKIALLLLLTGMIFLSACSRNYYSGSGKGSNCGCPSHKGMSGY*
Ga0062383_1000075543300004778Wetland SedimentMKTTNKIAFLLLISTIMILAGCNKNYYSGSGKGGKNCGCPSHKGMTGY*
Ga0062382_1051221313300004782Wetland SedimentQFMKTFNKIALLLLVAGMILVTGCNKNYYSGSGKGGNNCGCPSHKGMTGY*
Ga0062381_1004037223300004808Wetland SedimentMKTFNKIALLLLVAGMILVTGCNKNYYSGSGKGGNNCGCPSHKGMTGY*
Ga0062594_10004499643300005093SoilMKNIRKMSLLLLLAGVIVLSACNRNYYSGTGKGSSCGCPSHKGMSGY*
Ga0066685_1053175313300005180SoilKHKNKILALLLILGTIVAFSCNKNYYSGTGKGSNCGCPSHKGMAGY*
Ga0068993_1000478113300005183Natural And Restored WetlandsMKTINKIALIVLVAGILVVAGCSRNYYSGTGKGSNCGCPSHKGMVGY*
Ga0066671_1076068823300005184SoilMFRKNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY*
Ga0065715_1058366613300005293Miscanthus RhizosphereMKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGTKELAK
Ga0070683_10000653193300005329Corn RhizosphereMKRKNKIIVLLLLIGTVLAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0070683_10013071223300005329Corn RhizosphereMKRKNKIIVVLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0070683_10228518223300005329Corn RhizosphereMKRKNKIIVLLLLMGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY*
Ga0070670_10008860433300005331Switchgrass RhizosphereLEILFMKRKNKIIVLLLLLGTILALGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0070680_10201364713300005336Corn RhizosphereMKRKNKIIVLLLLMGTILAFGCNKNYYSGTGKGSNCGCPSHKGMV
Ga0070682_10123111413300005337Corn RhizosphereEILFMKRKNKIIVLLLLMGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0070668_10047115423300005347Switchgrass RhizosphereMKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY*
Ga0070671_10031473323300005355Switchgrass RhizosphereMKGKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0070674_10137804613300005356Miscanthus RhizosphereMKNIRKMSLLLLLAGVIVLSACNRNYYSGTGKGSSCGCPSHKGMS
Ga0070673_10188009923300005364Switchgrass RhizosphereMKRKNIIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMT
Ga0070667_10016077933300005367Switchgrass RhizosphereMKTINKIALVLLVVGMMVAGCNKNYYSGTGKGSSCGCPSHKGMS
Ga0070700_10059470323300005441Corn, Switchgrass And Miscanthus RhizosphereMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGNNCGCPSHKGMTGY*
Ga0070700_10073665213300005441Corn, Switchgrass And Miscanthus RhizosphereKMSLLLLLAGVIVLSACNRNYYSGTGKGSSCGCPSHKGMSGY*
Ga0070662_10063145443300005457Corn RhizosphereEILFMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0070672_10081724733300005543Miscanthus RhizosphereQKYTILLENSFNLEILFMKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY*
Ga0073903_1013454123300005657Activated SludgeMKTLSKIAIALLLVAFLAACNKNYYSGAGKGGKNCGCPSVR*
Ga0073900_1000682453300005659Activated SludgeMKSINKIVIALLLVMVLAACNRNYYSGSGKGGKNCGCPSTKGMSGY*
Ga0073900_1024713633300005659Activated SludgeMKTINKIVVALLVIVFLSACNKNYYSGSGKGGKNCGCPSHKGMTGY*
Ga0068861_10078458413300005719Switchgrass RhizosphereMKTINKIALVLLVVGMMVAGCNKNYYSGTGKGSSCGCPSHKGMSGY*
Ga0068861_10180370633300005719Switchgrass RhizospherePKYTILLENSFNLEILFMKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY*
Ga0074471_1051305533300005831Sediment (Intertidal)MKTINKLAIILLVMMFLTACSKNYYSGSGKGGKNCGCPSHKGMSGY*
Ga0074472_1051167723300005833Sediment (Intertidal)MKTIHKIAMLLIVAGMLIISGCNKNYYSGSGKGGKNCGCPSHKGMSGY*
Ga0068851_1050706713300005834Corn RhizosphereNSFNLEILFMKRKNKIIVLLLLLGTILALGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0074470_1120677233300005836Sediment (Intertidal)MKTINKIALVLLVAGMMIVAGCNRNYYSGTGKGSNCGCPSHKGMVGY*
Ga0068863_10056576113300005841Switchgrass RhizosphereFMKRKNKIIVLLLLLGTILALGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0068858_10038064533300005842Switchgrass RhizosphereMKTINKIALLLLLVGTMVAGCNKNYYSGTGKGSSCGCPSHKGMSGY*
Ga0068862_10060706123300005844Switchgrass RhizosphereMKRKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY*
Ga0081539_1004328533300005985Tabebuia Heterophylla RhizosphereMNRKNKILVLLLFLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGMSGY*
Ga0066652_10033890733300006046SoilYMKTINKIALLLLVVGMMVAGCNKNYYSGTGKGSSCGCPSHKGMSGY*
Ga0075163_1029984123300006056Wastewater EffluentMKNINKIAIALLLIVFLSACNKNYYSGSGKSSKGCGCPGQKGGSGW*
Ga0068871_10004066433300006358Miscanthus RhizosphereMKRKNKIIVLLLLMGTILASGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0075425_10025839633300006854Populus RhizosphereMKRKNNIFLLILLLGTILAFGCNKNYYSGTGKGSGCGCPSHKGMVGY*
Ga0075434_10193739323300006871Populus RhizosphereMNRKNKILVLMLLLGTIVAFGCNKNYYSGTGKGSNCGCPNHKGMSGY*
Ga0075434_10266134223300006871Populus RhizosphereMKRKNNIIILLLLLGTILAFGCNRNVYSGTGKGSNCGCPSHKGMVGY*
Ga0079218_1003472133300007004Agricultural SoilMKNIRKMSLLLLLAGMIFVSACNRNYYSGTGKGSNCGCPSHKGMSGY*
Ga0079218_1265058423300007004Agricultural SoilMKTIKKITLFLLLAGMVLVTSCNKNYYSGNGKGSNCGCPSTKGMSGY*
Ga0079224_10019716433300009095Agricultural SoilMKNVNKFTWLLLLAGVLFLAACNRNYYSGTGKGSNCGCPSHKGMVGY*
Ga0127503_1129681713300010154SoilKNIIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0134066_1016766513300010364Grasslands SoilNSFNLELHLMKQKNNIWLLILLIGTILAAGCNKNYYSGAGKGGNNCGCPSHKGMSGY*
Ga0134122_1008217533300010400Terrestrial SoilMKRKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGYK*
Ga0137776_181104743300010937SedimentEILIMKQKSKIIVLLLMLGIIVASCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0105246_1113864133300011119Miscanthus RhizosphereLEILFMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0105246_1257901613300011119Miscanthus RhizosphereKIALVLLVVGMMVAGCNKNYYSGTGKGSSCGCPSHKGMSGY*
Ga0137463_1000941103300011444SoilMKRKNNIFLLILLLGTILAFGCNKNYYSGSGKGSGCGCPAHKGMVGY*
Ga0137363_1101236913300012202Vadose Zone SoilFRTSFKESRGQIMKTINKIALLLLVAGILLVTGCNRNYYSGTGKGSNCGCPSHKGMSGY*
Ga0137374_1099246023300012204Vadose Zone SoilMNRKNKILVLLLLLGTIVAFGCNKNYYSGTGKGSNCGCPNHKGMSGY*
Ga0150985_10014887223300012212Avena Fatua RhizosphereKNNIFLLILLIGTILAIGCNKNYYSGSGKGSGCGCPTHKGMVGY*
Ga0150985_10299178213300012212Avena Fatua RhizosphereKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0150985_10564427513300012212Avena Fatua RhizosphereRKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0150985_10986117933300012212Avena Fatua RhizosphereHSKRLLAILLIMGIFFAAGCSRNYYSGTGKGSNCGCPSHKGMSGY*
Ga0137361_1145401913300012362Vadose Zone SoilMRQKNKILVLLLLLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGM
Ga0150984_12336582813300012469Avena Fatua RhizosphereYMKSINKIALLLLLAGMFLVSACNRNYYSGTGKGSNCGCPSHKGMSGY*
Ga0137407_1024887423300012930Vadose Zone SoilMKTTTKKIALLVLLTGMIILSACNKNYYSGSGKGSSCGCPSHKGMSGY*
Ga0126375_1053838113300012948Tropical Forest SoilNLEIQFMKGKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0164303_1018152313300012957SoilLFMKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY*
Ga0164299_1041617313300012958SoilRRNYILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0164301_1091999613300012960SoilILFMKRRNYILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0164309_1123443913300012984SoilLFMKGKNKIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0164308_1062949713300012985SoilVLLLLLGTILAFGCNKNYYSGTGKGNNCGCPSHKGMTGY*
Ga0157378_1189601713300013297Miscanthus RhizosphereNSFNLEILFMKRRNKILVILLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY*
Ga0157372_1226119133300013307Corn RhizosphereLFMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0132256_10003123443300015372Arabidopsis RhizosphereMKGKNKIIVLLLLMGTILASGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0132257_10229165013300015373Arabidopsis RhizosphereIRFMKTKNKIIVVLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY*
Ga0132255_10005392013300015374Arabidopsis RhizosphereQNNKILVLLLLLGTIVAFSCNKNYYSGTGKGSNCGCPSHKGMTGY*
Ga0180121_1029475523300017695Polar Desert SandMGQIMKIINKIAILLLLAGTVLFTACNKNYYSGSGKGGKNCGCPSNKGMTGY
Ga0136617_1106568413300017789Polar Desert SandMKTINKIALLLLLAGTVMFTACNKNYYSGSGKGGKNCGCPSHKGMSGY
Ga0187824_1000951913300017927Freshwater SedimentMKHKNKMVLLLLVLGIIVASGCNRNYYSGTGKGSNCGCPSHKGMVGY
Ga0187824_1003817233300017927Freshwater SedimentLEILFMKRNNKLALILVILGIILAAGCNKNYYSGTGKGSNCGCPSHKGMVGY
Ga0184615_1008130133300018059Groundwater SedimentMKKKNNIFLLILLMGTILAFGCNKNYYSGNGKGSGCGCPTNH
Ga0184636_132276113300018068Groundwater SedimentMKKKNNIFLLILLIGTILAFGCNKNYYSGNGKGSGCGCPTNH
Ga0190272_1012454133300018429SoilMKTINKIALLLLLAGMVVVSACNRNYYSGSGKGSNCGCPSQKGMSGY
Ga0190272_1237397423300018429SoilMTGGTYMKSINKLALLVLVAGMMLLASCNKNYYSGSGKGGKNCGCPNTKGMVGY
Ga0190274_1000498333300018476SoilMKNINKMTLLLSLAGMIFLSACSRNYYSGSGKGSNCGCPSHKGMSGY
Ga0190274_1003248523300018476SoilMKTISKIAVALLVIVFLAACNKNYYSGSGKGGKNCGCPSHKGMSGY
Ga0187893_10004319243300019487Microbial Mat On RocksMKNNQKLTLLLLLAGMIFLAACNRNYYSGTGKGSNCGCPSHKGMSGY
Ga0210402_1057521333300021478SoilMKQKNKIVLLLLILGIIVASGCNKNYYSGTGKGSNCGCPSHKGMTGY
Ga0247740_100128153300023092Plant LitterMKNIKKIALFLLVAGMVVVSSCNKNYYSGSGKGGKNCGCPSHKGMSGY
Ga0247760_105182523300023272Plant LitterMKTIQKIAVALGLIVLLAACNKNYYSGSGKGGKNCGCPSHKGMSGY
Ga0207710_1001087043300025900Switchgrass RhizosphereMKTINKIALLLLLVGTMVAGCNKNYYSGTGKGSSCGCPSHKGMSGY
Ga0207649_1064862013300025920Corn RhizosphereKNIIIVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMTGY
Ga0207681_1078543513300025923Switchgrass RhizosphereMKTIHKIALFLLLAGMVIMTSCQRNYYSGTGKGSNCGCPSHKGMTGY
Ga0207644_1179358923300025931Switchgrass RhizosphereNLEILFMKRKNKIIVLLLLMGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY
Ga0207706_1014287533300025933Corn RhizosphereLEILFMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY
Ga0207704_1176206713300025938Miscanthus RhizosphereVLLLLMGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVGY
Ga0207689_1001291613300025942Miscanthus RhizosphereKRLLAILLIMGIFFAAGCSRNYYSGTGKGSNCGCPSHKGMSGY
Ga0207712_1176012913300025961Switchgrass RhizosphereFGLRKGIRNKNMKSVHKIALLLVFAASILFAGCNKNYYSGSGKGGKNCGCPSHKGMTGY
Ga0207658_1029156913300025986Switchgrass RhizosphereMRVNNKIIAILLIMGIFFAAGCSRNYYSGTGKGSNCGCPSHKGMSGYSP
Ga0207677_1002018613300026023Miscanthus RhizosphereMKRRNKILVLLLLLGTILAFGCNKNYYSGTGKGSNCGCPSHKGMVG
Ga0207641_1005560033300026088Switchgrass RhizosphereMKTINRIAILLLAAGIILVTSCNKNYYSGSGKGGKNCGCPSHKGMSGY
Ga0207676_1108290113300026095Switchgrass RhizosphereNIRKMSLLLLLAGVIVLSACNRNYYSGTGKGSSCGCPSHKGMSGY
Ga0209170_100761743300027694Activated SludgeMKSINKIVIALLLVMVLAACNRNYYSGSGKGGKNCGCPSTKGMSGY
Ga0209797_1000322443300027831Wetland SedimentMKTFNKIALLLLVAGMILVTGCNKNYYSGSGKGGNNCGCPSHKGMTGY
Ga0209797_1001298943300027831Wetland SedimentMKTTNKIAFLLLISTIMILAGCNKNYYSGSGKGGKNCGCPSHKGMTGY
Ga0209683_10001595103300027840Wetland SedimentNKIAFLLLISTIMILAGCNKNYYSGSGKGGKNCGCPSHKGMTGY
Ga0209486_1090143623300027886Agricultural SoilMRTFNKIALFLLLAGMVLVTSCNKNYYSGTGKGSNCGCPSTKGMSGY
Ga0247723_112488613300028025Deep Subsurface SedimentMKNINKIAIALLLILFLSACNKNYYSGSGKSSKGCGCPGQKGGSGW
Ga0168092_1000936123300029239Activated SludgeMKTINKIVVALLLIVFLAACNKNYYSGSGKGGKNCGCPSHKGMSGY
Ga0307414_1024501033300032004RhizosphereMKKSIYILLLVIATITFASCNKNYYSGAGKGSNCGCPSKKGMVGY
Ga0307414_1025563733300032004RhizosphereMKKSIYILLLVASTALFTSCSKNYYSGSGKKSDCGCP
Ga0310902_1000488713300032012SoilNSFKFRIQNMKTINKMTLLLSLAGIIFLSACSRNYYSGSGKGSSCGCPSHKGMSGY
Ga0315292_1051667423300032143SedimentMKNINKMTLLLLLAGMIFLSACSRNYYSGSGKGSNCGCPS
Ga0310810_1075752533300033412SoilMMKKNKIVVLLLLLGTIVAFGCNKNYYSGTGKGSNCGCPSHKGMTGY
Ga0370508_0262203_97_2373300034197Untreated Peat SoilMKNINKIAIALLLIVFLSACNKNYYSGSGKSSKGCGCPGQKGGSGW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.