NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066982

Metagenome / Metatranscriptome Family F066982

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066982
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 46 residues
Representative Sequence MIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE
Number of Associated Samples 108
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 37.30 %
% of genes near scaffold ends (potentially truncated) 42.86 %
% of genes from short scaffolds (< 2000 bps) 73.02 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.206 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.635 % of family members)
Environment Ontology (ENVO) Unclassified
(39.683 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.444 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.16%    β-sheet: 7.89%    Coil/Unstructured: 78.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF00571CBS 6.35
PF02633Creatininase 3.97
PF11074DUF2779 3.97
PF02518HATPase_c 3.17
PF11329DUF3131 2.38
PF07732Cu-oxidase_3 2.38
PF00248Aldo_ket_red 1.59
PF13091PLDc_2 1.59
PF01432Peptidase_M3 1.59
PF00072Response_reg 0.79
PF00672HAMP 0.79
PF13493DUF4118 0.79
PF0563523S_rRNA_IVP 0.79
PF14322SusD-like_3 0.79
PF10518TAT_signal 0.79
PF14342DUF4396 0.79
PF00069Pkinase 0.79
PF00355Rieske 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG1402Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)Coenzyme transport and metabolism [H] 3.97
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.17
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 2.38
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 1.59
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 1.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.21 %
UnclassifiedrootN/A0.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090008|P3_DRAFT_NODE_99891_len_12829_cov_15_743394All Organisms → cellular organisms → Bacteria12879Open in IMG/M
2124908029|A2_v1_NODE_41704_len_594_cov_6_269360All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium644Open in IMG/M
2140918006|ConsensusfromContig62151All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium726Open in IMG/M
2140918007|ConsensusfromContig151183All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2237Open in IMG/M
2140918007|ConsensusfromContig31470All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1242Open in IMG/M
2162886012|MBSR1b_contig_1382380All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2909Open in IMG/M
3300001305|C688J14111_10265468All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium540Open in IMG/M
3300001535|A3PFW1_10327525All Organisms → cellular organisms → Bacteria1523Open in IMG/M
3300001664|P5cmW16_1038963All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium860Open in IMG/M
3300001686|C688J18823_10018672All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium4646Open in IMG/M
3300001686|C688J18823_11003135All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium529Open in IMG/M
3300004114|Ga0062593_100035798All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2902Open in IMG/M
3300004153|Ga0063455_100762969All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium663Open in IMG/M
3300004157|Ga0062590_100347633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1185Open in IMG/M
3300004643|Ga0062591_100836658All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium854Open in IMG/M
3300005179|Ga0066684_10460147All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium855Open in IMG/M
3300005179|Ga0066684_10776249All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium635Open in IMG/M
3300005187|Ga0066675_10269555All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1222Open in IMG/M
3300005336|Ga0070680_100001480All Organisms → cellular organisms → Bacteria17062Open in IMG/M
3300005450|Ga0066682_10841882All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium551Open in IMG/M
3300005457|Ga0070662_101386676All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium605Open in IMG/M
3300005458|Ga0070681_10118075All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2589Open in IMG/M
3300005458|Ga0070681_10479307All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1157Open in IMG/M
3300005563|Ga0068855_102118259All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium566Open in IMG/M
3300005566|Ga0066693_10095073All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1068Open in IMG/M
3300005578|Ga0068854_100574438All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium959Open in IMG/M
3300005578|Ga0068854_101759090All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium568Open in IMG/M
3300005616|Ga0068852_101870800All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium622Open in IMG/M
3300005896|Ga0075282_1037916All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium668Open in IMG/M
3300005938|Ga0066795_10024349All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1738Open in IMG/M
3300005938|Ga0066795_10130751All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium748Open in IMG/M
3300005938|Ga0066795_10136485All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium731Open in IMG/M
3300005947|Ga0066794_10115593All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium804Open in IMG/M
3300006046|Ga0066652_100423960All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1218Open in IMG/M
3300006055|Ga0097691_1000321All Organisms → cellular organisms → Bacteria43666Open in IMG/M
3300006175|Ga0070712_100883622All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium770Open in IMG/M
3300006797|Ga0066659_11008368All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium696Open in IMG/M
3300006864|Ga0066797_1065181All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1279Open in IMG/M
3300006881|Ga0068865_100548882All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium970Open in IMG/M
3300006894|Ga0079215_10908826All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium633Open in IMG/M
3300006903|Ga0075426_10494042All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium909Open in IMG/M
3300007265|Ga0099794_10439790All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium683Open in IMG/M
3300009012|Ga0066710_100524454All Organisms → cellular organisms → Bacteria1789Open in IMG/M
3300009012|Ga0066710_102849754All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium681Open in IMG/M
3300009029|Ga0066793_10197345All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1172Open in IMG/M
3300009093|Ga0105240_10054889All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium4991Open in IMG/M
3300009143|Ga0099792_10017360All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium3149Open in IMG/M
3300009143|Ga0099792_11030014All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium551Open in IMG/M
3300009147|Ga0114129_10049008All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium5937Open in IMG/M
3300009148|Ga0105243_12306709All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium576Open in IMG/M
3300010227|Ga0136219_1001158All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium3548Open in IMG/M
3300010320|Ga0134109_10065368All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1224Open in IMG/M
3300010322|Ga0134084_10301092All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium596Open in IMG/M
3300010371|Ga0134125_12056964All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium621Open in IMG/M
3300010373|Ga0134128_12312609All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium592Open in IMG/M
3300010399|Ga0134127_10130220All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2254Open in IMG/M
3300011332|Ga0126317_10975572All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium792Open in IMG/M
3300011444|Ga0137463_1047989All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1587Open in IMG/M
3300011444|Ga0137463_1075275All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1265Open in IMG/M
3300011998|Ga0120114_1003009All Organisms → cellular organisms → Bacteria4579Open in IMG/M
3300012201|Ga0137365_10664154All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium763Open in IMG/M
3300012203|Ga0137399_11029009All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium693Open in IMG/M
3300012208|Ga0137376_10200904All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1724Open in IMG/M
3300012211|Ga0137377_10023674All Organisms → cellular organisms → Bacteria → Proteobacteria5472Open in IMG/M
3300012285|Ga0137370_10308340All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium946Open in IMG/M
3300012469|Ga0150984_109431812All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium685Open in IMG/M
3300012927|Ga0137416_10408998All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300012930|Ga0137407_11684790All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium604Open in IMG/M
3300012951|Ga0164300_11049008All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium528Open in IMG/M
3300012955|Ga0164298_10646315All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium734Open in IMG/M
3300012955|Ga0164298_11281725All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium560Open in IMG/M
3300012958|Ga0164299_10774195All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium681Open in IMG/M
3300012960|Ga0164301_10640742All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium791Open in IMG/M
3300012985|Ga0164308_11001306All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium743Open in IMG/M
3300013100|Ga0157373_10051772All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2923Open in IMG/M
3300013102|Ga0157371_10443986All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium953Open in IMG/M
3300014056|Ga0120125_1068043All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium801Open in IMG/M
3300014745|Ga0157377_10855385All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium676Open in IMG/M
3300014829|Ga0120104_1120996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300015084|Ga0167654_1021153All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300015192|Ga0167646_1011475All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2432Open in IMG/M
3300015192|Ga0167646_1030361All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1325Open in IMG/M
3300015371|Ga0132258_13375211All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1097Open in IMG/M
3300015373|Ga0132257_100340934All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1810Open in IMG/M
3300018056|Ga0184623_10170021All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1006Open in IMG/M
3300018482|Ga0066669_10030493All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium3178Open in IMG/M
3300019879|Ga0193723_1028355All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1695Open in IMG/M
3300019881|Ga0193707_1001258All Organisms → cellular organisms → Bacteria9202Open in IMG/M
3300019881|Ga0193707_1107506All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium826Open in IMG/M
3300019890|Ga0193728_1002413All Organisms → cellular organisms → Bacteria9596Open in IMG/M
3300020004|Ga0193755_1037957All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1585Open in IMG/M
3300020006|Ga0193735_1002878All Organisms → cellular organisms → Bacteria5559Open in IMG/M
3300020021|Ga0193726_1011196All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium4812Open in IMG/M
3300020021|Ga0193726_1043612All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2166Open in IMG/M
3300020022|Ga0193733_1091842All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium849Open in IMG/M
3300020060|Ga0193717_1043902Not Available1630Open in IMG/M
3300020061|Ga0193716_1004581All Organisms → cellular organisms → Bacteria → Proteobacteria7427Open in IMG/M
3300021339|Ga0193706_1213583All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium519Open in IMG/M
3300021363|Ga0193699_10117742All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300021408|Ga0193708_1015030All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1878Open in IMG/M
3300021411|Ga0193709_1005155All Organisms → cellular organisms → Bacteria3355Open in IMG/M
3300021411|Ga0193709_1097421All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium635Open in IMG/M
3300022756|Ga0222622_10494442All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium873Open in IMG/M
3300025505|Ga0207929_1000225All Organisms → cellular organisms → Bacteria16005Open in IMG/M
3300025912|Ga0207707_10031676All Organisms → cellular organisms → Bacteria4628Open in IMG/M
3300025912|Ga0207707_10652532All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium887Open in IMG/M
3300025917|Ga0207660_10017723All Organisms → cellular organisms → Bacteria4737Open in IMG/M
3300025919|Ga0207657_10674605All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium804Open in IMG/M
3300025939|Ga0207665_10686615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium804Open in IMG/M
3300025949|Ga0207667_11611246All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium618Open in IMG/M
3300025981|Ga0207640_12112026All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium511Open in IMG/M
3300026271|Ga0209880_1020928All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1605Open in IMG/M
3300026271|Ga0209880_1075826All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium704Open in IMG/M
3300026271|Ga0209880_1089485All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium633Open in IMG/M
3300026316|Ga0209155_1022440All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2629Open in IMG/M
3300027565|Ga0209219_1008736All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2294Open in IMG/M
3300027903|Ga0209488_10036930All Organisms → cellular organisms → Bacteria3572Open in IMG/M
3300028536|Ga0137415_10057107All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium3770Open in IMG/M
3300028824|Ga0307310_10057472All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1640Open in IMG/M
3300028828|Ga0307312_10292195All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1060Open in IMG/M
3300030510|Ga0268243_1169237All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium535Open in IMG/M
3300031716|Ga0310813_10097159All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2282Open in IMG/M
3300031720|Ga0307469_10039912All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2839Open in IMG/M
3300032002|Ga0307416_101106383All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium897Open in IMG/M
3300033412|Ga0310810_10319545All Organisms → cellular organisms → Bacteria1654Open in IMG/M
3300034820|Ga0373959_0068962All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium796Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.52%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil6.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.56%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.76%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil3.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.38%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil2.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.38%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.59%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.59%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.79%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.79%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.79%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.79%
SoilEngineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2124908029Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
2140918006Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1EnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300010227Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2EngineeredOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015084Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine)EnvironmentalOpen in IMG/M
3300015192Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021408Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c1EnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025505Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026271Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_DRAFT_002940302088090008SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWNKRDARFERDPNE
A2_v1_002675702124908029SoilPQTFDASPIEEMDPVECPACHQMHRWNKKDARFERDPNE
P1_C_001241102140918006SoilMIYTGFSMDPQTFEASPIEEMDPVECPACHQTHRWNKRDARFERDPNE
A_all_C_003284102140918007SoilMIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWNKKDARFERDPNE
A_all_C_014597702140918007SoilMIYTGFSMDPQTFEDSPIEQMDPVECPACRQMHRWNKKDARFERDPNE
MBSR1b_0235.000059602162886012Miscanthus RhizosphereMIYTGFSMDPLTFEASPIEEMDPIVCPACHKTHKWSKKDARFERDPNE
C688J14111_1026546823300001305SoilGKMIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE*
A3PFW1_1032752513300001535PermafrostFEASPIEEMDPIECPACHQTHRWNKRDARFERDPNE*
P5cmW16_103896333300001664PermafrostMIYTGFSMDPQTFEASPIEEMDPIICPACHQTHKWSKKDARFERDPNE*
C688J18823_1001867223300001686SoilMIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE*
C688J18823_1100313523300001686SoilMIYTGYSMDPIIFEASPIEEMDPVECPACHQTHRWSKRDARFERDPNE*
Ga0062593_10003579843300004114SoilMIYTGYAMDPQTFEASPIEEMDPIECPACHQVHRWTKRDARFERDPNE*
Ga0063455_10076296923300004153SoilMIYTGYSMDPQTFDASPIEEMDPIQCPACRQVHSWSKRDARFERDPNE*
Ga0062590_10034763323300004157SoilMDPATFDASPVEENPIECPVCKQTHRWSKKDAFLERDDSAERAH*
Ga0062591_10083665813300004643SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHKTHRWSKKDARFERDPNE*
Ga0066684_1046014733300005179SoilMIYTGYSMDPQTFEASPIEEMDPIECPACHQMHRWSKRDARFERDPNE*
Ga0066684_1077624933300005179SoilKMIYTGYSMDPAIFEASPIEEMDPVVCPACHQTHRWSKRDARFERDPNE*
Ga0066675_1026955513300005187SoilMIYTGYSMDPAIFEASPIEEMDPVVCPACHQTHRWSKRDARFERDPNE*
Ga0070680_10000148073300005336Corn RhizosphereMIYTGYAMDPLTFEASPIEEMDPIECPACHQLHHWTKKDARFERDPNE*
Ga0066682_1084188213300005450SoilMIYTGYSMDPQTFEASPIEEMDPIECPACHQMHRWTKRDARFERDPNE*
Ga0070662_10138667623300005457Corn RhizosphereGYSMDPQTFELSPIEEMDPVECPACHQTHRWTKRQALFERDPNE*
Ga0070681_1011807533300005458Corn RhizosphereMIYTGYSMDPAIFEASPIEEMDPIQCPVCHQTHRWTKRDARFERDPNE*
Ga0070681_1047930713300005458Corn RhizosphereDPQTFEASPIEEMDPIQCPACHQVHAWSKRDARFERDPNE*
Ga0068855_10211825913300005563Corn RhizosphereFEASPIEEMDPIECPACHQLHHWTKKDARFERDPNE*
Ga0066693_1009507313300005566SoilGYSMDPAIFEASPIEEMDPVVCPACHQTHRWSKRDARFERDPNE*
Ga0068854_10057443823300005578Corn RhizosphereMIYTGYAMDPQTFEASPIEEMDPIECPACHQVHRWTKRDARFEREPNE*
Ga0068854_10175909013300005578Corn RhizosphereYTGFSMDPLTFEASPIEEMDPIVCPACHKTHKWSKKDARFERDPNE*
Ga0068852_10187080013300005616Corn RhizosphereASPIEEMDPIECPACHQVHRWTKRDARFERDPNE*
Ga0075282_103791613300005896Rice Paddy SoilMIYTGYAMDPQTFEASPIEEMDPIECPACHQIHRWT
Ga0066795_1002434933300005938SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWNKRDA
Ga0066795_1013075133300005938SoilTGKMIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWSKKDARFERDPNE*
Ga0066795_1013648523300005938SoilTGKMIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWSKADARFERDPNE*
Ga0066794_1011559313300005947SoilMIYTGFSMDPQTFEDSPIEEMDPVECSACHQMHRWNKKDARFERDPNE*
Ga0066652_10042396033300006046SoilTGKMIYTGYSMDPAIFEASPIEEMDPVVCPACHQTHRWSKRDARFERDPNE*
Ga0097691_1000321253300006055Arctic Peat SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWNKRDARFERDPNE*
Ga0070712_10088362233300006175Corn, Switchgrass And Miscanthus RhizosphereTFEASPIEEMDPIECPACHQTHRWSKRDARFERDPNE*
Ga0066659_1100836833300006797SoilTFEASPIDEMDPIECPACHQTHRWTKRDARFERDPNE*
Ga0066797_106518123300006864SoilMIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWSKKDARFERDPNE*
Ga0068865_10054888213300006881Miscanthus RhizosphereMIYTGYSMDPQTFDLSPIEEMDPVECPACHQVHRWSKRDARFERDPNE*
Ga0079215_1090882623300006894Agricultural SoilMDQATFTASPIEQMDPIECPACHKMHRWAKKDALFEREDPKENRR*
Ga0075426_1049404213300006903Populus RhizosphereFELSPIEEMDPVECPACHQTHRWTKKQALFERDPNE*
Ga0099794_1043979013300007265Vadose Zone SoilMIYTGFSMDPQTFEASPIEEMDPVQCPACRQLHRWTKKDARFERDPNE*
Ga0066710_10052445413300009012Grasslands SoilTTGKMIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWTKRDARFERDPNE
Ga0066710_10284975413300009012Grasslands SoilTFEASPIEEMDPIECPACHQTHRWTKRDARFERDPNE
Ga0066793_1019734533300009029Prmafrost SoilMIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWSKADARFERDPNE*
Ga0105240_1005488963300009093Corn RhizosphereMIYTGFSMDPLTFEASPIEEMDPIVCPACHKTHKWSKKDARFERDPNE*
Ga0099792_1001736013300009143Vadose Zone SoilMIYTGFSMDPQTFEASPIEEMDPIVCPACHQTHKWSKKDA
Ga0099792_1103001413300009143Vadose Zone SoilMIYTGFSMDPQTFEASPIEEMDPIVCPACHQTHKWSKKDARFERDPNE*
Ga0114129_1004900843300009147Populus RhizosphereMVYTGYSMDPQTFELSPIEEMDPVVCPACHQTHRWTKKQALFERDPNE*
Ga0105243_1230670913300009148Miscanthus RhizosphereQTFEASPIEEMDPIPCPACHQTHRWTKKDALFKRDPNE*
Ga0136219_100115843300010227SoilMIYTGYAMDPQTFEASPIEEMDPIECPACHQIHRWTKRDARFERDPNE*
Ga0134109_1006536823300010320Grasslands SoilMIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWTKRDARFERDPNE*
Ga0134084_1030109223300010322Grasslands SoilMDPQTFELSPIEEMDPVECPACHQMHRWTKKQALFERDPNE*
Ga0134125_1205696423300010371Terrestrial SoilMIYTGYSMDPQTFEASPIEEMDPIQCPACHQVHSWSKRDARFERDPNE*
Ga0134128_1231260913300010373Terrestrial SoilIKCPNTGKMIYTGYSMDPQTFELSPIEEMDPVECPACHQMHRWTKRQALFERDPNE*
Ga0134127_1013022023300010399Terrestrial SoilMIYTGYSMDPQTFEASPIEEMDPIQCPACHQVHAWSKRDARFERDPNE*
Ga0126317_1097557213300011332SoilIKCPNTGKMIYTGFSMDPLIFEASPVEEMDPIECPACHQTHRWSKKDSRFERDPNE*
Ga0137463_104798923300011444SoilMIYTGFSMDPSTFDASPIEEMDPIECPACHQMHRWSKKDARFERDPNE*
Ga0137463_107527523300011444SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHQTHKWNKRDARFERDPNE*
Ga0120114_100300913300011998PermafrostTGFSMDPQTFEASPIEEMDPIECPACHQTHRWNKRDARFERDPNE*
Ga0137365_1066415423300012201Vadose Zone SoilMIYTGYSMDPQTFEASPIEEMDPIQCPACHQTHRWTKRDARFERDPNE*
Ga0137399_1102900923300012203Vadose Zone SoilMIYTGYSMDPETFEGSPIEEMDPVECPACHQVHRWSKRDARFERDPNE*
Ga0137376_1020090423300012208Vadose Zone SoilMIYTGYSMDPQTFEASPIEEMDPIECPACHQVHRWSKRDARFERDPNE*
Ga0137377_1002367433300012211Vadose Zone SoilMIYTGYSMDPQTFDASPIEEMDPIECPACHQTHRWSKRDARFERDPNE*
Ga0137370_1030834033300012285Vadose Zone SoilMIYTGYSMDPQTFELSPIEEMDPVECPACHQTHRWTKRQALFERDPNE*
Ga0150984_10943181213300012469Avena Fatua RhizosphereASPIEEMDPIECPACHQVHAWSKRDARFERDPNE*
Ga0137416_1040899833300012927Vadose Zone SoilYSMDPQTFEASPIEEMDPIQCPACHQMHRWSKREARFERDPNE*
Ga0137407_1168479023300012930Vadose Zone SoilYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWSKRDARFERDPNE*
Ga0164300_1104900813300012951SoilMIYTGYSMDPQTFELSPIEEMDPVVCPACHQTHRWTKKQALFERDPNE*
Ga0164298_1064631523300012955SoilMIYTGYSMDPAIFEASPIEEMDPIVCPACRQTHTWTNKDA
Ga0164298_1128172513300012955SoilATGKMIYTGYSMDPAIFEASPIEEMDPIECPACRQTHTWTKKDARFERDPNE*
Ga0164299_1077419513300012958SoilMIYTGYSMDPQTFELSPIEEMDPVECPACHQMHRWTKRQALFERDPNE*
Ga0164301_1064074223300012960SoilMIYTGYSMDPAIFEASPIEEMDPIVCPACRQTHTWTKKDARFERDPNE*
Ga0164308_1100130623300012985SoilMIYTGYSMDPQTFEAAPIEEMDPIQCPACHQVHAWSKRDARFERDPNE*
Ga0157373_1005177253300013100Corn RhizosphereMIYTGYAMDPQTFEASPIEEMDPIECPACHQVHRWTKRDARF
Ga0157371_1044398623300013102Corn RhizosphereQTFELSPIEEMDPVECPACHQVHRWSKRDARFERDPNE*
Ga0120125_106804323300014056PermafrostMIYTGFSMDPQTFEASPIEEMDPIVCPACHQTHRWSKKDARFERDPNE*
Ga0157377_1085538523300014745Miscanthus RhizosphereEPEVLHTWALSPIEEMDPVECPACHQVHRWSKRDARFERDPNE*
Ga0120104_112099613300014829PermafrostQTFEASPIEEMDPIICPACHQTHKWSKKDARFERDPNE*
Ga0167654_102115323300015084Glacier Forefield SoilMIYTGYSMDPTTFGAIPIEQMDPIECPACKRMHRWGKKDALFEREDPKEGEKKAK*
Ga0167646_101147523300015192Glacier Forefield SoilMIYTGFSMDPQTFDASPIEEMDPIECPACHQMHRWSKKDARFERDPNE*
Ga0167646_103036123300015192Glacier Forefield SoilMIYTGFSMDPQTFEASPIEEMDPVECPACHQTHRWNKRDARFERDPNE*
Ga0132258_1337521123300015371Arabidopsis RhizosphereDPETFELSPIEEMDPVECPACHQVHRWSKRDARFERDPNE*
Ga0132257_10034093433300015373Arabidopsis RhizosphereMIYTGYSMDPQTFEASPIEEMDPIQCPACHQVHAWSKRDA
Ga0184623_1017002133300018056Groundwater SedimentVNRIFIKCPTTGKLVYTGFEMDQDTFTAIPIEQMDPIECPACHEMHRWAKKDALFEREDPKERSR
Ga0066669_1003049353300018482Grasslands SoilCPNTGKMIYTGYSMDPAIFEASPVEEMDPIECPACRQTHRWSKRDARFERDPNE
Ga0193723_102835523300019879SoilMIYTGFSMDPITFDAAPIEEMDPIECPACHKMHRWTKKDARFERDPNE
Ga0193707_100125843300019881SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHQMHRWNKRDARFERDPNE
Ga0193707_110750623300019881SoilMIYTGFSMDPITFDASPIEEMDPIECPACHKMHRWTKKDALFERDPNE
Ga0193728_100241393300019890SoilMIYTGFSMDPLTFEASPIEEMDPIVCPACHQTHKWSKKDARFERDPNE
Ga0193755_103795733300020004SoilYTGFAMDPETFGALPIEEMDPLECPACHKIHRWQKKDALFEREDPRAAS
Ga0193735_100287863300020006SoilMIYTGFSMDPQTFEASPIEEMDPIVCPACHQTHKWSKKDARFERDPNE
Ga0193726_101119643300020021SoilMIYTGFSMDPATFDAAPIEEMDPVECPACHQTHRWTKKDARFERDPNE
Ga0193726_104361233300020021SoilMIYTGFSMDPITFDASPIEEMDPIECPACHKMHRWTKKDARFERDPNE
Ga0193733_109184223300020022SoilMIYTGFSMDPQIFEASPIEEMDPIVCPACHQTHRWSKKDARFERDPNE
Ga0193717_104390213300020060SoilGFAMDQATFGALPIEEMDPIECPACHKMHRWAKKDALFEREDPQSK
Ga0193716_100458113300020061SoilMIYTGFSMDPQTFEASPIEEMDPVECPACHQMHRWSKKDARFERDPNE
Ga0193706_121358313300021339SoilMIYTGFSMDPQTFDASPIEEMDPVECPACHQTHRWSKKDARFERDPNE
Ga0193699_1011774233300021363SoilYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE
Ga0193708_101503033300021408SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE
Ga0193709_100515513300021411SoilPTTGKMIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE
Ga0193709_109742123300021411SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERD
Ga0222622_1049444233300022756Groundwater SedimentGKLIYTGFAMDPETFGALPIEEMDPLECPACHKVHRWQKKDALFEREDPRAAS
Ga0207929_1000225103300025505Arctic Peat SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHQPHRWNKRDARFERDPNE
Ga0207707_1003167623300025912Corn RhizosphereMIYTGYAMDPQTFEASPIEEMDPIECPACHQVHRWTKRDARFERDPNE
Ga0207707_1065253223300025912Corn RhizosphereMIYTGYSMDPAIFEASPIEEMDPIQCPVCHQTHRWTKRDARFERDPNE
Ga0207660_1001772313300025917Corn RhizosphereMIYTGYAMDPLTFEASPIEEMDPIECPACHQLHHWTKKDARFERDPNE
Ga0207657_1067460523300025919Corn RhizosphereMIYTGYAMDPLTFEASPIEEMDPIECPACHQLHHWTKKDA
Ga0207665_1068661513300025939Corn, Switchgrass And Miscanthus RhizosphereMIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWSKRDARFERDPNE
Ga0207667_1161124623300025949Corn RhizosphereFEASPIEEMDPIECPACHQLHHWTKKDARFERDPNE
Ga0207640_1211202613300025981Corn RhizosphereMIYTGYAMDPQTFEASPIEEMDPIECPACHQVHRWTKRDARFERD
Ga0209880_102092843300026271SoilMIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWSK
Ga0209880_107582613300026271SoilGFSMDPQTFDASPIEEMDPVECPACHQMHRWSKADARFERDPNE
Ga0209880_108948513300026271SoilGFSMDPQTFDASPIEEMDPVECPACHQMHRWSKKDARFERDPNE
Ga0209155_102244033300026316SoilMIYTGYSMDPAIFEASPIEEMDPVVCPACHQTHRWSKRDARFERDPNE
Ga0209219_100873643300027565Forest SoilMIYTGFSMDPQTFEASPIEEMDPIQCPACRQMHRWTKRDARFERDPNE
Ga0209488_1003693043300027903Vadose Zone SoilMIYTGYSMDPQTFGAIPIEQMDPIECPACHKMHRWGKEDALFERDSQDPKKSSR
Ga0137415_1005710713300028536Vadose Zone SoilMIYTGYSMDPQTFEASPIEEMDPIQCPACHQMHRWSKRDARFERDPNE
Ga0307310_1005747223300028824SoilMIYTGYSMDPKTFGAIPIEQMDPIECPACHRMHRWGKQDALFEREGPDPKQK
Ga0307312_1029219523300028828SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHKTHRWNKRDARFERDPNE
Ga0268243_116923713300030510SoilMIYTGYSMDPQTFESSPIEEMDPIECPACHQTHRWTKKQALF
Ga0310813_1009715933300031716SoilMIYTGFSMDPLTFEASPIEEMDPLVCPACHQTHKWSKKDARFERDPNE
Ga0307469_1003991233300031720Hardwood Forest SoilMIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWSKRDARFERDPNE
Ga0307416_10110638323300032002RhizosphereMIYTGYSMDPEIFAASPIEELDPIQCPICHKTHRWTKKDARFERDPNE
Ga0310810_1031954523300033412SoilYTGFSMDPLTFEASPIEEMDPLVCPACHQTHKWSKKDARFERDPNE
Ga0373959_0068962_626_7723300034820Rhizosphere SoilMIYTGYSMDPAIFEASPIEEMDPIECPACRQTHTWTKKDARFERDPNE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.