NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071206

Metagenome / Metatranscriptome Family F071206

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071206
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 51 residues
Representative Sequence DNALIARKFRALGFSGVRVSGAGAIRRVEGVWPRKDASATLPPQIVAVAGL
Number of Associated Samples 109
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.28 %
% of genes near scaffold ends (potentially truncated) 95.90 %
% of genes from short scaffolds (< 2000 bps) 92.62 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (54.918 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(22.951 % of family members)
Environment Ontology (ENVO) Unclassified
(31.967 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.262 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.92%    β-sheet: 13.92%    Coil/Unstructured: 72.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF00383dCMP_cyt_deam_1 8.20
PF00912Transgly 2.46
PF17201Cache_3-Cache_2 2.46
PF00487FA_desaturase 1.64
PF14497GST_C_3 1.64
PF14437MafB19-deam 1.64
PF03776MinE 1.64
PF08241Methyltransf_11 0.82
PF13406SLT_2 0.82
PF00011HSP20 0.82
PF02586SRAP 0.82
PF14023DUF4239 0.82
PF04545Sigma70_r4 0.82
PF00440TetR_N 0.82
PF04546Sigma70_ner 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 2.46
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 2.46
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 2.46
COG0851Septum formation topological specificity factor MinECell cycle control, cell division, chromosome partitioning [D] 1.64
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 1.64
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 1.64
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.82
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.82
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms54.92 %
UnclassifiedrootN/A45.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002077|JGI24744J21845_10100195Not Available535Open in IMG/M
3300002245|JGIcombinedJ26739_100634946All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300004114|Ga0062593_103513249All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300004156|Ga0062589_100731635All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300004157|Ga0062590_100770154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium880Open in IMG/M
3300004463|Ga0063356_103601273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria667Open in IMG/M
3300004479|Ga0062595_102225424Not Available538Open in IMG/M
3300004481|Ga0069718_16024066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria940Open in IMG/M
3300005332|Ga0066388_102044564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1029Open in IMG/M
3300005343|Ga0070687_101440699Not Available516Open in IMG/M
3300005438|Ga0070701_10602835All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005456|Ga0070678_101619207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria608Open in IMG/M
3300005457|Ga0070662_100584001Not Available939Open in IMG/M
3300005549|Ga0070704_101735941Not Available577Open in IMG/M
3300005563|Ga0068855_101878538Not Available607Open in IMG/M
3300005614|Ga0068856_102117615Not Available572Open in IMG/M
3300005841|Ga0068863_100234615Not Available1770Open in IMG/M
3300005843|Ga0068860_100191257All Organisms → cellular organisms → Bacteria1981Open in IMG/M
3300005937|Ga0081455_10024840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5539Open in IMG/M
3300005952|Ga0080026_10092491Not Available835Open in IMG/M
3300006050|Ga0075028_100968200All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300006057|Ga0075026_100957640Not Available530Open in IMG/M
3300006086|Ga0075019_10140306All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300006605|Ga0074057_12225675All Organisms → cellular organisms → Bacteria → Proteobacteria1030Open in IMG/M
3300006845|Ga0075421_100977925All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300009094|Ga0111539_11016642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales964Open in IMG/M
3300009094|Ga0111539_11863248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium697Open in IMG/M
3300009147|Ga0114129_13338409Not Available518Open in IMG/M
3300009148|Ga0105243_11775934Not Available647Open in IMG/M
3300009156|Ga0111538_11761402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria780Open in IMG/M
3300009156|Ga0111538_12569828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria639Open in IMG/M
3300009157|Ga0105092_10055936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2123Open in IMG/M
3300009174|Ga0105241_12112095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium557Open in IMG/M
3300009545|Ga0105237_10910564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium886Open in IMG/M
3300009551|Ga0105238_12533465Not Available549Open in IMG/M
3300009553|Ga0105249_11787555Not Available687Open in IMG/M
3300009792|Ga0126374_11606236Not Available537Open in IMG/M
3300010046|Ga0126384_12302833Not Available520Open in IMG/M
3300010375|Ga0105239_13428972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus515Open in IMG/M
3300010396|Ga0134126_11289436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria809Open in IMG/M
3300010400|Ga0134122_10056383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3027Open in IMG/M
3300010400|Ga0134122_10311964Not Available1355Open in IMG/M
3300010400|Ga0134122_11082773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria792Open in IMG/M
3300012004|Ga0120134_1046703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium744Open in IMG/M
3300012513|Ga0157326_1051705Not Available605Open in IMG/M
3300012884|Ga0157300_1080757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300012905|Ga0157296_10213137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria625Open in IMG/M
3300012911|Ga0157301_10081559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium911Open in IMG/M
3300012913|Ga0157298_10042367All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300012951|Ga0164300_10012212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2745Open in IMG/M
3300012951|Ga0164300_10743666Not Available600Open in IMG/M
3300012955|Ga0164298_10890061Not Available646Open in IMG/M
3300012957|Ga0164303_10035383Not Available2094Open in IMG/M
3300012958|Ga0164299_11085762All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300012960|Ga0164301_10843549Not Available705Open in IMG/M
3300012960|Ga0164301_10969665Not Available666Open in IMG/M
3300012961|Ga0164302_10152459All Organisms → cellular organisms → Bacteria → Proteobacteria1363Open in IMG/M
3300012961|Ga0164302_10373343Not Available962Open in IMG/M
3300012961|Ga0164302_11401196All Organisms → cellular organisms → Bacteria → Proteobacteria571Open in IMG/M
3300012984|Ga0164309_11111121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B34658Open in IMG/M
3300012984|Ga0164309_11798674Not Available525Open in IMG/M
3300012987|Ga0164307_11701899Not Available534Open in IMG/M
3300012988|Ga0164306_10054905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer → Ensifer psoraleae2425Open in IMG/M
3300012989|Ga0164305_12241231Not Available503Open in IMG/M
3300013096|Ga0157307_1033398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium904Open in IMG/M
3300013297|Ga0157378_12367053Not Available583Open in IMG/M
3300013306|Ga0163162_12847336Not Available557Open in IMG/M
3300013308|Ga0157375_11002386Not Available975Open in IMG/M
3300015200|Ga0173480_10549457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria700Open in IMG/M
3300015372|Ga0132256_100163459All Organisms → cellular organisms → Bacteria2247Open in IMG/M
3300018469|Ga0190270_10577144Not Available1090Open in IMG/M
3300018469|Ga0190270_10862335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria919Open in IMG/M
3300018476|Ga0190274_11569997Not Available750Open in IMG/M
3300019356|Ga0173481_10220108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria836Open in IMG/M
3300022756|Ga0222622_11077683Not Available591Open in IMG/M
3300022901|Ga0247788_1090191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium599Open in IMG/M
3300023057|Ga0247797_1024029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens800Open in IMG/M
3300025899|Ga0207642_11125357Not Available508Open in IMG/M
3300025901|Ga0207688_10198202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B341203Open in IMG/M
3300025918|Ga0207662_10371057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales965Open in IMG/M
3300025933|Ga0207706_11668417Not Available514Open in IMG/M
3300025937|Ga0207669_11597561Not Available556Open in IMG/M
3300025937|Ga0207669_11859901Not Available514Open in IMG/M
3300025938|Ga0207704_11585308Not Available562Open in IMG/M
3300025942|Ga0207689_10675796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium870Open in IMG/M
3300025949|Ga0207667_11235832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B34725Open in IMG/M
3300025960|Ga0207651_11837583Not Available545Open in IMG/M
3300025961|Ga0207712_10943716Not Available764Open in IMG/M
3300025981|Ga0207640_12125502Not Available509Open in IMG/M
3300026035|Ga0207703_12348221Not Available509Open in IMG/M
3300026075|Ga0207708_11411925Not Available611Open in IMG/M
3300026078|Ga0207702_10466783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1227Open in IMG/M
3300026089|Ga0207648_11616674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300026118|Ga0207675_101077342Not Available823Open in IMG/M
3300026121|Ga0207683_11678587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria585Open in IMG/M
3300026142|Ga0207698_11054127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales825Open in IMG/M
3300027743|Ga0209593_10334582Not Available517Open in IMG/M
3300027907|Ga0207428_11089522Not Available559Open in IMG/M
3300027909|Ga0209382_10112269All Organisms → cellular organisms → Bacteria3184Open in IMG/M
3300028381|Ga0268264_12492174Not Available523Open in IMG/M
3300028828|Ga0307312_11150670Not Available513Open in IMG/M
3300030019|Ga0311348_10770082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales717Open in IMG/M
3300031170|Ga0307498_10019267All Organisms → cellular organisms → Bacteria → Proteobacteria1529Open in IMG/M
3300031184|Ga0307499_10056875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B34975Open in IMG/M
3300031364|Ga0307445_10199866All Organisms → cellular organisms → Bacteria → Proteobacteria703Open in IMG/M
3300031446|Ga0170820_12230410Not Available1567Open in IMG/M
3300031538|Ga0310888_10256422All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300031565|Ga0307379_10160295Not Available2351Open in IMG/M
3300031565|Ga0307379_11590472Not Available515Open in IMG/M
3300031768|Ga0318509_10487419Not Available689Open in IMG/M
3300031908|Ga0310900_10251140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B341274Open in IMG/M
3300031944|Ga0310884_10093083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium1460Open in IMG/M
3300032012|Ga0310902_10329519All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300032179|Ga0310889_10163972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. B341005Open in IMG/M
3300032180|Ga0307471_102136468Not Available704Open in IMG/M
3300032205|Ga0307472_100528837All Organisms → cellular organisms → Bacteria → Proteobacteria1024Open in IMG/M
3300032516|Ga0315273_12132314Not Available660Open in IMG/M
3300033004|Ga0335084_10766661All Organisms → cellular organisms → Bacteria → Proteobacteria981Open in IMG/M
3300033416|Ga0316622_102646377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria577Open in IMG/M
3300033551|Ga0247830_11192868Not Available608Open in IMG/M
3300033551|Ga0247830_11254568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium592Open in IMG/M
3300034077|Ga0373899_018345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria753Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.95%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.74%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.10%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.28%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.28%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.46%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.64%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.64%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.64%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.64%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.82%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.82%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.82%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.82%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.82%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.82%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.82%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.82%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002077Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012513Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510Host-AssociatedOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031364Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034077Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.3EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24744J21845_1010019513300002077Corn, Switchgrass And Miscanthus RhizosphereTSVRVSGSGAKRKVEGVWPGKDMSANLPRQIVAVAKL*
JGIcombinedJ26739_10063494623300002245Forest SoilKSVELLADNALIAQKFRDLGFSRVRVSGAGATRRVEGVWPGRDTSANMPPQIVAVAAL*
Ga0062593_10351324923300004114SoilDNELIARKFRALGFSRVRVSGAGATRRVEGVWPGKDTSASMPPQIVAVAKL*
Ga0062589_10073163513300004156SoilDNALIARKFRALGFSKVRVSGTGAIRLVEGVWPRKDASAPLPPQIVAVAVI*
Ga0062590_10077015413300004157SoilTLSLNSVERLADNNLIERKFRALGFSGVRVSGTGAIRRVEGVWPRKDASAPLPPQIVAVARL*
Ga0063356_10360127323300004463Arabidopsis Thaliana RhizosphereADNALIARKFRALGFSGVRVSGAGAIRRVEGVWPRKDASATLPPQIIAVAGL*
Ga0062595_10222542413300004479SoilLADNALIARKFRALGFSRVRVSGTGAKRRVEGVWHLKDASTTLPRQIVAVAGL*
Ga0069718_1602406613300004481SedimentDNELIARKFRALGFAKVRVSGSGATRKVEGVWPGKDASAPLPRQIVAVARM*
Ga0066388_10204456413300005332Tropical Forest SoilLNSVERLADNAQIARKFRALGFTSVHVSGTGAMRRVEGVWHHKDASTTLPRQIVAVAGL*
Ga0070687_10144069923300005343Switchgrass RhizosphereVDNGAIAQKFRALGFTSVRVSGSGATRKVEGVWPGKDMSTNMPRQIVAVAKL*
Ga0070701_1060283513300005438Corn, Switchgrass And Miscanthus RhizosphereLGFSKVRVSGTGAIRLVEGVWPRKDASAPLPPQIVAVAVI*
Ga0070678_10161920713300005456Miscanthus RhizosphereLADNELIARKFRALGFARVHVSGSGATRKVEGVWPGKDASAPLPRQIVAVARM*
Ga0070662_10058400133300005457Corn RhizosphereKFRALGFSKVHVSGSGATRRVEGVWPGKDVSTPLPSQIVAVAKL*
Ga0070704_10173594113300005549Corn, Switchgrass And Miscanthus RhizosphereRALGFSGVRVSGTGAKRRVEGVWHLKDASTTLPRQIVAVAGL*
Ga0068855_10187853823300005563Corn RhizosphereVDNASIAQKFRALGFTSVRVSGSGATRKVEGVWPGKDMSTNMPRQIVAVAKL*
Ga0068856_10211761513300005614Corn RhizosphereVERLVDNGAIAQKFRALGFTSVRVSGSGATRKVEGVWPGKDMSTNMPRQIVAVAKL*
Ga0068863_10023461553300005841Switchgrass RhizosphereVERLVDNDLIARKFRALGFSKVRVSGAGAIRRVEGVWPREDASASLPRQIVAVARL*
Ga0068860_10019125753300005843Switchgrass RhizosphereSVERLVDNGAIAQKFRALGFTSVRVSGSGATRKVEGVWPGKDMSTNMPRQIVAVAKL*
Ga0081455_1002484013300005937Tabebuia Heterophylla RhizosphereIEKFADNALIAQKFRSLGFARVRVSGAGATRRVEGVWIGKDVRGNMPAQIVAVANL*
Ga0080026_1009249123300005952Permafrost SoilQLADNGTIAQKFRDLGFSGVRVSGSGATRRVVGVWPGKDTRANMPPQIVAVASL*
Ga0075028_10096820013300006050WatershedsKFRAMGFMRVRVSGAGATRRVEGVWPGKDTSANLPPQIVAVAGL*
Ga0075026_10095764023300006057WatershedsLADNALIASKFRALGFSRVHVSGTGAIRRIEGVWHRKDASATLPRQIVAVGLSSGSM*
Ga0075019_1014030613300006086WatershedsTRVRVSGAGAMRRVEGVWPGKDTSANLPPQIVAVAGL*
Ga0074057_1222567513300006605SoilSVRVSGSGATRKVEGVWPGKDMSANMPRQIVAVARL*
Ga0075421_10097792513300006845Populus RhizosphereVERLADNALIARKFRALGFSKVRVSGTGAIRLVEGVWPRKDASAPLPPQIVAVAVI*
Ga0111539_1101664213300009094Populus RhizosphereRLADNALIARKFRALGFSKVRVSGAGAVRRVEGIWHRKDASATLPRQIVAVARL*
Ga0111539_1186324813300009094Populus RhizosphereSLNAVERLTDNALIARKFRAIGFSKVRVSGSGAVRRVEGVWSRKDASTTLPRQIVAVARL
Ga0114129_1333840923300009147Populus RhizosphereSGVRVSGAGAIRRVEGVWPRKDASATLPPQIVAVAGL*
Ga0105243_1177593413300009148Miscanthus RhizosphereGFSKVHVSGSGATRRVEGVWPGKDVSTPLPSQIVAVAKL*
Ga0111538_1176140223300009156Populus RhizosphereALIAKKFRALGFSRVHVSGTGAMRRVEGVWHRKDANATLPRQIVAVAGL*
Ga0111538_1256982813300009156Populus RhizosphereSVERLADNELIARKFRALGFARVHVSGSGATRKVEGVWPGKDASAPLPRQIVAVARM*
Ga0105092_1005593633300009157Freshwater SedimentMLSLNSVKRLADNALIASKFRAIGFSKVRVSGAGAVRHVEGVWPRKDASTNLPPQIIAVAGL*
Ga0105241_1211209513300009174Corn RhizosphereKFRALGFSGVRVSGTGATRRVEGVWPRKDASAPLPPQIVAVARL*
Ga0105237_1091056413300009545Corn RhizosphereSKFRALGFSGVRVSGTGATRRVEGVWPRKDASAPLPPQIVAVARL*
Ga0105238_1253346513300009551Corn RhizosphereVERLAGNAQIAQKFRALGFVSVRVAGSGAKRRVEGVWPGKETSANLPRQIVAVAKL*
Ga0105249_1178755513300009553Switchgrass RhizosphereNALIARKFRALGFSKVRVSGAGAVRRVEGVWHRKDASTTLPRQIVTVAGL*
Ga0126374_1160623613300009792Tropical Forest SoilLNSVEQLADNALIARKFRALGFSRVHVSGSGATRRVEGVWPGKDASATMPPQIVAVAGL*
Ga0126384_1230283313300010046Tropical Forest SoilRAILSLKSMERLVDNTLIAQKFRDLGFTGVRVSGAGAMRRVEGIWPGKDTSATLPPQIVAVAKL*
Ga0105239_1342897213300010375Corn RhizosphereQLADNALIARKFRALGFSRVHVSGTGAMRRVEGVWHRKDASATLPRQIVAVAGL*
Ga0134126_1128943613300010396Terrestrial SoilFRALGFSRVRVSGTGAKRRVEGVWHLKDASTTLPRQIVAVAGL*
Ga0134122_1005638363300010400Terrestrial SoilRALGFVSVRVSGSGATRKVEGVSPGKETSANLPRQNVAVARL*
Ga0134122_1031196443300010400Terrestrial SoilTLALNSVEQLADNALIARKFRALGFSRVRVSGTGAKRRVEGVWHLKDASTTLLRQIVAVAGL*
Ga0134122_1108277313300010400Terrestrial SoilLALNSVEQLADNALIARKFRALGFSRVRVSGTGAMRRVEGVWHRKDASATLPRQIVAVAGL*
Ga0120134_104670313300012004PermafrostLHLNSVERLVDNALIESKFRALGFSGVRVSGTGATRRVEGVWPRNDASAPLPPQIVAVARL*
Ga0157326_105170513300012513Arabidopsis RhizosphereATLSLNSVERLADNALIARKFRALGFSKVRVSGAGPVRRVEGVWHRKDASATLPRQIVAVASL*
Ga0157300_108075713300012884SoilFRALGFSKVHVLGSGATRRVEGVWPRKNARTPLPSQVVAVARV*
Ga0157296_1021313713300012905SoilKSVERLADNELIARKFRALGFAKVRVSGSGATRKVEGVWPGKDASAPLPHQIVAVARM*
Ga0157301_1008155913300012911SoilLIESKFRALGFSGVRVSGTGATRRVEGVWPRKDASAPLPPQIVAVARL*
Ga0157298_1004236723300012913SoilSVERLADNALIARKFRALGFSKVRVSGTGAIRLVEGVWPRKDASAPLPPQIVGVARL*
Ga0164300_1001221213300012951SoilQKFRDLGFAGVKVSGAGATRRVEGVWPGKDTSANMPPQIVAVAKL*
Ga0164300_1074366613300012951SoilELIARKFRALGFSKVHVSGSGATRRVEGVWPGKDVSTPLPSQIVAVAKL*
Ga0164298_1089006113300012955SoilADNALIARKFRALGFSRVRVSGTGAMRRVEGVWFHKDASATLPRQIVAVDGL*
Ga0164303_1003538333300012957SoilLADNALIARKFRALGFSRVRVSGTGAMRRVEGVWFRKDASATLPRQIVAVDGL*
Ga0164299_1108576213300012958SoilRAILALRSMERLVDNALIAQKSRDLGFAGVKVSGAGATRRVEGVWPGKDTSANMPPQIVAVAKL*
Ga0164301_1084354913300012960SoilYCATLALNSVERLADNALIARKFRALGFSRVRVSGTGAMRRAEGLWLRKDATAPLPHQIVEVAKL*
Ga0164301_1096966513300012960SoilYCATLALNSVERLADNALIARKFRALGFSRVRVSGTGAMRRVEGVWFRKDASATLPRQIVAVDGL*
Ga0164302_1015245923300012961SoilMERLVDNPLIAQKFRDLGFAGVKVSGAGATRRVEGVWPGKDTSANMPPQIVAVAKL*
Ga0164302_1037334313300012961SoilAILALKSMERLVDNALIAQKFRDLGFAGVRVSGAGATRRVEGVWPGKDTSANMPPQIVAVAKL*
Ga0164302_1140119613300012961SoilLSLLCRRVMERLGDNALNAQKFRDLGFAGVKVSSAGATRRVEGVWPGKDTSANMPPQIVAVAKL*
Ga0164309_1111112123300012984SoilFTSVRVSGSGATRKVEGVWPGKNMSTNMPRQIVAVAKL*
Ga0164309_1179867413300012984SoilLALRSMERLVDNPLIAQKFRDLGFAGVRVSGAGATRRVEGVWPGKDTSANMPPQIVAVAKL*
Ga0164307_1170189923300012987SoilLGFSGVRVSGTGAKRRVEGVWHLKDASTTLPRQIVAVAGL*
Ga0164306_1005490553300012988SoilGFSKVRVSGAGAVRRVEGVSPRKDASATLPRQIVAVAGL*
Ga0164305_1224123113300012989SoilRKVRALGFSGVRVSGTGAKRRVEGVWRLKDASTTLPRQIVAVAGL*
Ga0157307_103339823300013096SoilYRATLHLNSVERLVDNGLIESKFRALGFSGVRVSGTGATRRVEGVWPRKDASAPLPPQIVAVARL*
Ga0157378_1236705313300013297Miscanthus RhizosphereRYQATLSLNSVELSDNALIAEKFRAMGFSKVRVSGAGAVRRVEGVWSRNDASATLPRQIVAVARL*
Ga0163162_1284733613300013306Switchgrass RhizosphereSVERLTDNALIARRFRALGFSKVRVSGAGAVRRVEGVWRRKDASATLPRQIVAVASL*
Ga0157375_1100238623300013308Miscanthus RhizosphereRALGFSKVHVSGSGATRRVEGVWPGKDVSTPLPSQIVAVAKL*
Ga0173480_1054945713300015200SoilELIARKFRALGFSKVHVSGSGATRRVEGVWPRKNASAPLPSQIVAVARV*
Ga0132256_10016345923300015372Arabidopsis RhizosphereVRVSGSGATRKVEGVWAGKDMSANMPRQIVAVAGL*
Ga0190270_1057714413300018469SoilGFSKVRVSGAGAVSSVEGVWTRKNASGSLPRQIVAVARL
Ga0190270_1086233513300018469SoilARKFRALGFSKVRVSGSGATRRVEGVWPGKDASAPLPRQIVAVARM
Ga0190274_1156999723300018476SoilYRATLSLNAIECLTDNVLIARKFRALGFSKVRVSGAGAVRSVEGVWTRKNASGSLPRQIVAVARL
Ga0173481_1022010823300019356SoilVERLADNELIARKFRALGFSKVHVSGSGATRRVEGVWPRKNARTPLPSQVVAVARV
Ga0222622_1107768313300022756Groundwater SedimentATLSLSSVERMVDNDAIAQRFRALGFTSVRVSGSGATRKVEGVWPGKDMSANMPRQIVAVAKL
Ga0247788_109019113300022901SoilLVDNALIESKFRALGFSGVRVSGTGATRRVEGVWPRKDASAPLPPQIVAVARL
Ga0247797_102402923300023057SoilDNELIARKFRALGFAKVRVSGSGATRKVEGVWPGKDASAPLPHQIVAVARM
Ga0207642_1112535723300025899Miscanthus RhizosphereRALGFSRVRVSGTGAKRRVEGVWHLKDASTTLPRQIVAVAGL
Ga0207688_1019820233300025901Corn, Switchgrass And Miscanthus RhizosphereQKFRALGFVSVRVSGSGAKRRVEGVWPGKETSANLPPQIVAVAKL
Ga0207662_1037105733300025918Switchgrass RhizosphereAQKFRALGFTSVRVSGSGATRKVEGVWPGKDMSTNMPRQIVAVAKL
Ga0207706_1166841713300025933Corn RhizosphereTSVRVSGSGATRKVEGVWPGKDMSANLPRQIVAVAKL
Ga0207669_1159756123300025937Miscanthus RhizosphereLGFTSVRVSGSGAKRKVEGVWPGKDMSANLPRQIVAVAKL
Ga0207669_1185990123300025937Miscanthus RhizosphereKVRVSGAGAVRRVEGVWSRNDASATLPRQIVAVARL
Ga0207704_1158530833300025938Miscanthus RhizosphereLALNSVERLADNALIARRFRALGFSKVRVSGAGAVRRVEGVWSRNDASATLPRQIVAVAR
Ga0207689_1067579613300025942Miscanthus RhizosphereIESKFRALGFSGVRVSGTGATRRVEGVWPRKDASAPLPPQIVAVARL
Ga0207667_1123583213300025949Corn RhizosphereDNGAIAQKFRALGFTSVRVSGSGATRKVEGVWPGKDMSTNMPRQIVAVAKL
Ga0207651_1183758313300025960Switchgrass RhizosphereNTLIARKFRALGFSGVHVSGTGAMRRVEGVWHRKDASATLPRQIVAVARL
Ga0207712_1094371613300025961Switchgrass RhizosphereLIARKFRALGFSKVRVSGAGAVRRVEGVWHRKDASTTLPRQIVTVAGL
Ga0207640_1212550223300025981Corn RhizosphereSIAQRFRALGFTSVRVSGSGATRKVEGVWPGKDMSTNMPRQIVAVAKL
Ga0207703_1234822123300026035Switchgrass RhizosphereSVRVSGSGATRKVEGVWPGKDMSTNMPRQIVAVAKL
Ga0207708_1141192513300026075Corn, Switchgrass And Miscanthus RhizosphereALGFSKVRVSGAGAIRRVEGVWPREDASASLPRQIVAVARL
Ga0207702_1046678333300026078Corn RhizosphereVRVSGSGATRKVEGVWPGKDMSTNMPRQIVAVAKL
Ga0207648_1161667413300026089Miscanthus RhizosphereRLADNELIARKFRALGFAKVRVSGSGATRKVEGVWPGKDASAPLPHQIVAVARM
Ga0207675_10107734213300026118Switchgrass RhizosphereSKVRVSGAGAVRRVEGVWHRKDASTTLPRQIVTVAGL
Ga0207683_1167858723300026121Miscanthus RhizosphereLADNELIARKFRALGFARVHVSGSGATRKVEVVWPGKDASAPLPRQIVAVARM
Ga0207698_1105412733300026142Corn RhizosphereAQIAQKFRALGFVSVRVSGSGAKRRVEGVWPGKETSANLPPQIVAVAKL
Ga0209593_1033458213300027743Freshwater SedimentKFRALGFSDVRVTGLGAIRRVEGFWSRKDASTPLPPQIIAVARL
Ga0207428_1108952223300027907Populus RhizosphereVRVSGAGAVRRVEGIWHRKDASATLPRQIVAVARL
Ga0209382_1011226933300027909Populus RhizosphereATLREGLPQNELADTISRAFRALGFTRVHVSGSGSTRKVEGVWPGKDASAPLPRQIVAVARM
Ga0268264_1249217413300028381Switchgrass RhizosphereSLNSVEQLADNAMIAQKFRDMGFSRVRVSGAGAMRRVEGVWPGNDSSAHMPHQIVAVARL
Ga0307312_1115067013300028828SoilALSPVEQLADNALIARKFRALGFSSVRVSGTGAKRRVEGVWHRKDASTTLPRQIVAVAGL
Ga0311348_1077008233300030019FenFRDVGFSRVRVSGSGAIRHVEGVWPGQDASANMPSQIVSVAIL
Ga0307498_1001926753300031170SoilSSVRVSGAGAKRRVEGVWHRKDASTTLPRQIVAVAGL
Ga0307499_1005687523300031184SoilALGFTSVRVSGSGATRKVEGVWPGKDMSTNMPRQIVAVAKL
Ga0307445_1019986623300031364Salt MarshPVEQLADNALIARKFRALGFSKVHVSGAGATRRVEGVWPGKDMSATMPPQIVAVATLR
Ga0170820_1223041013300031446Forest SoilLGFSRVRVSGTGAVRRVEGVWFRKDASATLPRQIVAVDGL
Ga0310888_1025642233300031538SoilRALGFSKVRVSGTGAIRLVEGVWPRKDASAPLPPQIVAVAVI
Ga0307379_1016029513300031565SoilPVEQLADNALIARKFSALGFSKVRVSGAGATRRVEGVWPGKDTSATMPHQIVAVATLR
Ga0307379_1159047223300031565SoilPVEQLADNALIARKFSALGFSKVRVSGAGATRRVEGVWPGKDASATMPHQIVAVATLR
Ga0318509_1048741913300031768SoilADNALIARKFRALGFSSVRVSGAGAMRQVEGVWPRETATAPLPREIVAVSRL
Ga0310900_1025114043300031908SoilAQIAQKFRALGFVSVRVSGSGAKRRVEGVWPGKETSANLPRQIVAVAKL
Ga0310884_1009308313300031944SoilAQKFRALGFVSARVSGSGAKRRVEGVWPGKETSANPPPQIVAVAKL
Ga0310902_1032951933300032012SoilVERLADNALIARKFRALGFSKVRVSGTGAIRLVEGVWPRKDASAPLPPQIVAVAVI
Ga0310889_1016397213300032179SoilSVERMADNAQIAQKFRALGFTSVRVSGSGAKRKVEGVWPGKDMSTNMPRQIVAVAKL
Ga0307471_10213646823300032180Hardwood Forest SoilDNALIARKFRALGFSGVRVSGAGAIRRVEGVWPRKDASATLPPQIVAVAGL
Ga0307472_10052883733300032205Hardwood Forest SoilTVHQGERYRAILALRSMERLVDNPLIAQKFRDLGFAGVKVSGAGATRRVEGVWPGKDTSANMPPQIVAVAKP
Ga0315273_1213231413300032516SedimentSVEQLADNALIAQKFRDLGFSRVRVSGAGATRRVEGVWPGNDTSANMPPQIVAVAKL
Ga0335084_1076666133300033004SoilLGFSKVHVSGSGATRRVEGVWPGKDISTPLPSQIVAVAKL
Ga0316622_10264637713300033416SoilLGFAKVRVSGSGATRRVEGVWPGKDVSAPLPSQIVAVARM
Ga0247830_1119286823300033551SoilVERLADNAQIAQKFRALGFTSVRVSGSGARRKVEGVWPGKDMSANLPRQIVAVAKL
Ga0247830_1125456813300033551SoilLTDNALIARKFRAIGFSKVRVSGSGAVRRVEGVWSRKDASTTLPRQIVAVARL
Ga0373899_018345_615_7523300034077Sediment SlurryRKFRALGFAKVRVSGSGATRKVEGVWPGKDASAPLPRQIVAVARM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.