Metagenome / Metatranscriptome Family F076350

Basic Information
Family ID	F076350
Family Type	Metagenome / Metatranscriptome
Number of Sequences	118
Average Sequence Length	43 residues
Representative Sequence	MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSEPEVEILART
Number of Associated Samples	107
Number of Associated Scaffolds	118

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	24.79 %
% of genes near scaffold ends (potentially truncated)	98.31 %
% of genes from short scaffolds (< 2000 bps)	90.68 %
Associated GOLD sequencing projects	104
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.52

Most Common Taxonomy
Group	Bacteria (91.525 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (6.780 % of family members)
Environment Ontology (ENVO)	Unclassified (31.356 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (32.203 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 15.28% β-sheet: 15.28% Coil/Unstructured: 69.44%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 118 Family Scaffolds
PF01613	Flavin_Reduct	70.34
PF01063	Aminotran_4	16.10
PF07943	PBP5_C	4.24
PF08240	ADH_N	0.85
PF01266	DAO	0.85
PF13358	DDE_3	0.85
PF01814	Hemerythrin	0.85
PF02347	GDC-P	0.85

COG ID	Name	Functional Category	% Frequency in 118 Family Scaffolds
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	70.34
COG0115	Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase	Amino acid transport and metabolism [E]	32.20
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	4.24
COG0403	Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain	Amino acid transport and metabolism [E]	0.85
COG1003	Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain	Amino acid transport and metabolism [E]	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	91.53 %
Unclassified	root	N/A	8.47 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	91.53 %
Unclassified	root	N/A	8.47 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	91.53 %
Unclassified	root	N/A	8.47 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	87.29 %
Unclassified	root	N/A	8.47 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	73.73 %
Unclassified	root	N/A	8.47 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.69 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5.08 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	5.08 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	1.69 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.85 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.08 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	3.39 %
Sphingosinicellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae	0.85 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.85 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.85 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.85 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.08 %
Massilia group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group	2.54 %
unclassified Oxalobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae	0.85 %
Pacificimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Pacificimonas	0.85 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.85 %
Novosphingobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium	0.85 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.85 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.08 %
Massilia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	2.54 %
Pseudomonas juntendi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi	0.85 %
unclassified Novosphingobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium	0.85 %
unclassified Pacificimonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Pacificimonas → unclassified Pacificimonas	0.85 %
Oxalobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium	0.85 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.85 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.08 %
unclassified Massilia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia	2.54 %
Pacificimonas sp. WHA3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Pacificimonas → unclassified Pacificimonas → Pacificimonas sp. WHA3	0.85 %
Novosphingobium sp. Gsoil 351	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. Gsoil 351	0.85 %
Pseudomonas juntendi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi	0.85 %
Oxalobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium	0.85 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.85 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	8.47 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	5.08 %
Massilia sp. PAMC28688	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. PAMC28688	2.54 %
Pacificimonas sp. WHA3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Pacificimonas → unclassified Pacificimonas → Pacificimonas sp. WHA3	0.85 %
Novosphingobium sp. Gsoil 351	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. Gsoil 351	0.85 %
Pseudomonas juntendi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi	0.85 %
Oxalobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium	0.85 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.85 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	0.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908036\|A5_v_NODE_5793_len_1478_cov_6_558187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1528	Open in IMG/M
2124908044\|A5_c1_ConsensusfromContig31580	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	6157	Open in IMG/M
3300000559\|F14TC_102559314	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	573	Open in IMG/M
3300000579\|AP72_2010_repI_A01DRAFT_1065954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	534	Open in IMG/M
3300000837\|AP72_2010_repI_A100DRAFT_1061131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	534	Open in IMG/M
3300000893\|AP72_2010_repI_A001DRAFT_1081401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	511	Open in IMG/M
3300004011\|Ga0055460_10150865	Not Available	698	Open in IMG/M
3300004157\|Ga0062590_101756156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	634	Open in IMG/M
3300004633\|Ga0066395_10958853	All Organisms → cellular organisms → Bacteria → Proteobacteria	520	Open in IMG/M
3300005329\|Ga0070683_102058828	All Organisms → cellular organisms → Bacteria	548	Open in IMG/M
3300005354\|Ga0070675_100030522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4352	Open in IMG/M
3300005355\|Ga0070671_101185232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	672	Open in IMG/M
3300005437\|Ga0070710_10646718	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	741	Open in IMG/M
3300005575\|Ga0066702_10447638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	791	Open in IMG/M
3300005719\|Ga0068861_100377079	All Organisms → cellular organisms → Bacteria → Proteobacteria	1252	Open in IMG/M
3300005844\|Ga0068862_100185362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1870	Open in IMG/M
3300005844\|Ga0068862_102656362	Not Available	512	Open in IMG/M
3300005947\|Ga0066794_10084120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	948	Open in IMG/M
3300006032\|Ga0066696_10625087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	697	Open in IMG/M
3300006034\|Ga0066656_11063299	All Organisms → cellular organisms → Bacteria → Proteobacteria	520	Open in IMG/M
3300006046\|Ga0066652_100286885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1456	Open in IMG/M
3300006057\|Ga0075026_100236871	All Organisms → cellular organisms → Bacteria	974	Open in IMG/M
3300006175\|Ga0070712_100230262	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1471	Open in IMG/M
3300006224\|Ga0079037_101871099	All Organisms → cellular organisms → Bacteria → Proteobacteria	600	Open in IMG/M
3300006358\|Ga0068871_100695531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	931	Open in IMG/M
3300006796\|Ga0066665_10251779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1398	Open in IMG/M
3300006800\|Ga0066660_11274517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	575	Open in IMG/M
3300006953\|Ga0074063_12460082	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	756	Open in IMG/M
3300007281\|Ga0104349_1036418	All Organisms → cellular organisms → Bacteria → Proteobacteria	1381	Open in IMG/M
3300009551\|Ga0105238_10274600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1666	Open in IMG/M
3300010043\|Ga0126380_10406572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1013	Open in IMG/M
3300010051\|Ga0133939_1125915	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1302	Open in IMG/M
3300010339\|Ga0074046_10049333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2801	Open in IMG/M
3300010341\|Ga0074045_10002836	All Organisms → cellular organisms → Bacteria → Proteobacteria	15864	Open in IMG/M
3300010347\|Ga0116238_10185040	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi	1471	Open in IMG/M
3300010373\|Ga0134128_12169735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	612	Open in IMG/M
3300010398\|Ga0126383_13592218	All Organisms → cellular organisms → Bacteria	507	Open in IMG/M
3300011119\|Ga0105246_11519904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	629	Open in IMG/M
3300012096\|Ga0137389_10599498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	946	Open in IMG/M
3300012228\|Ga0137459_1154464	All Organisms → cellular organisms → Bacteria → Proteobacteria	675	Open in IMG/M
3300012361\|Ga0137360_10527291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. Gsoil 351	1007	Open in IMG/M
3300012987\|Ga0164307_10663677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	812	Open in IMG/M
3300013296\|Ga0157374_11502901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	697	Open in IMG/M
3300013297\|Ga0157378_10465463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1257	Open in IMG/M
3300013307\|Ga0157372_12039760	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	659	Open in IMG/M
3300013503\|Ga0120127_10171855	Not Available	527	Open in IMG/M
3300013831\|Ga0120126_1000508	All Organisms → cellular organisms → Bacteria → Acidobacteria	1549	Open in IMG/M
3300014326\|Ga0157380_10993776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	872	Open in IMG/M
3300014969\|Ga0157376_10819338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	944	Open in IMG/M
3300015080\|Ga0167639_1019319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	961	Open in IMG/M
3300015371\|Ga0132258_10239433	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4428	Open in IMG/M
3300015371\|Ga0132258_11518229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1692	Open in IMG/M
3300015372\|Ga0132256_101527008	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	778	Open in IMG/M
3300015373\|Ga0132257_102122244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	726	Open in IMG/M
3300015374\|Ga0132255_101030072	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1235	Open in IMG/M
3300015374\|Ga0132255_102039923	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	873	Open in IMG/M
3300016371\|Ga0182034_10918245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	753	Open in IMG/M
3300017965\|Ga0190266_10458024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	729	Open in IMG/M
3300018029\|Ga0187787_10233405	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	664	Open in IMG/M
3300018064\|Ga0187773_10778979	Not Available	605	Open in IMG/M
3300018075\|Ga0184632_10412408	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	566	Open in IMG/M
3300018084\|Ga0184629_10366909	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	758	Open in IMG/M
3300018084\|Ga0184629_10581868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium	573	Open in IMG/M
3300018433\|Ga0066667_11207286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	658	Open in IMG/M
3300019887\|Ga0193729_1072676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1354	Open in IMG/M
3300021331\|Ga0210347_1271813	Not Available	593	Open in IMG/M
3300025588\|Ga0208586_1082690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	703	Open in IMG/M
3300025703\|Ga0208357_1031187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1890	Open in IMG/M
3300025927\|Ga0207687_10641712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	898	Open in IMG/M
3300025933\|Ga0207706_10353657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1277	Open in IMG/M
3300025935\|Ga0207709_10154581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1593	Open in IMG/M
3300025937\|Ga0207669_10300443	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1220	Open in IMG/M
3300025945\|Ga0207679_10272741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1447	Open in IMG/M
3300025961\|Ga0207712_11048245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	725	Open in IMG/M
3300026041\|Ga0207639_10675286	All Organisms → cellular organisms → Bacteria	957	Open in IMG/M
3300026067\|Ga0207678_11604498	All Organisms → cellular organisms → Bacteria → Proteobacteria	573	Open in IMG/M
3300026088\|Ga0207641_11012916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	827	Open in IMG/M
3300026089\|Ga0207648_11051545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	763	Open in IMG/M
3300027890\|Ga0209496_10256933	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	858	Open in IMG/M
3300028380\|Ga0268265_12433913	Not Available	530	Open in IMG/M
3300028770\|Ga0302258_1170553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Pacificimonas → unclassified Pacificimonas → Pacificimonas sp. WHA3	538	Open in IMG/M
3300029923\|Ga0311347_10279231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1021	Open in IMG/M
3300029980\|Ga0302298_10223233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. PAMC28688	619	Open in IMG/M
3300029984\|Ga0311332_11408544	All Organisms → cellular organisms → Bacteria → Proteobacteria	564	Open in IMG/M
3300029987\|Ga0311334_11187577	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	639	Open in IMG/M
3300029990\|Ga0311336_11361035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	622	Open in IMG/M
3300030000\|Ga0311337_11560103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. PAMC28688	579	Open in IMG/M
3300031544\|Ga0318534_10806485	All Organisms → cellular organisms → Bacteria → Proteobacteria	527	Open in IMG/M
3300031595\|Ga0265313_10274565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. PAMC28688	682	Open in IMG/M
3300031719\|Ga0306917_11329774	Not Available	555	Open in IMG/M
3300031720\|Ga0307469_10251198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1423	Open in IMG/M
3300031720\|Ga0307469_11727686	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	603	Open in IMG/M
3300031740\|Ga0307468_100160260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1461	Open in IMG/M
3300031831\|Ga0318564_10286313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	729	Open in IMG/M
3300031902\|Ga0302322_102240392	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	672	Open in IMG/M
3300031941\|Ga0310912_10000624	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	17906	Open in IMG/M
3300031946\|Ga0310910_10799569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	743	Open in IMG/M
3300031999\|Ga0315274_10088309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4058	Open in IMG/M
3300031999\|Ga0315274_11404955	All Organisms → cellular organisms → Bacteria → Proteobacteria	672	Open in IMG/M
3300032039\|Ga0318559_10031612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2119	Open in IMG/M
3300032163\|Ga0315281_11675234	Not Available	618	Open in IMG/M
3300032173\|Ga0315268_10910843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	883	Open in IMG/M
3300032177\|Ga0315276_11482106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	707	Open in IMG/M
3300032180\|Ga0307471_102141618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	704	Open in IMG/M
3300032256\|Ga0315271_10181659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1672	Open in IMG/M
3300032397\|Ga0315287_11062206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	939	Open in IMG/M
3300032397\|Ga0315287_11936368	Not Available	651	Open in IMG/M
3300032770\|Ga0335085_10110119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3537	Open in IMG/M
3300033419\|Ga0316601_102326157	All Organisms → cellular organisms → Bacteria → Proteobacteria	539	Open in IMG/M
3300033433\|Ga0326726_10712528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	969	Open in IMG/M
3300033482\|Ga0316627_100018838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3539	Open in IMG/M
3300033482\|Ga0316627_101299925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	725	Open in IMG/M
3300033488\|Ga0316621_10091677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1679	Open in IMG/M
3300033488\|Ga0316621_10334410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1009	Open in IMG/M
3300034129\|Ga0370493_0029188	All Organisms → cellular organisms → Bacteria → Proteobacteria	1674	Open in IMG/M
3300034129\|Ga0370493_0147992	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	769	Open in IMG/M
3300034417\|Ga0364941_129242	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	625	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	71.19%
Host-Associated	Host-Associated	26.27%
Engineered	Engineered	2.54%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	56.78%
Plants	Host-Associated → Plants	26.27%
Aquatic	Environmental → Aquatic	14.41%
Wastewater	Engineered → Wastewater	2.54%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	48.31%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.25%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.17%
Freshwater	Environmental → Aquatic → Freshwater	8.47%
Peat	Environmental → Terrestrial → Peat	7.63%
Sediment	Environmental → Aquatic → Sediment	4.24%
Marine	Environmental → Aquatic → Marine	1.69%
Floodplain	Environmental → Terrestrial → Floodplain	0.85%
Roots	Host-Associated → Plants → Roots	0.85%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.85%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.85%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	33.05%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	11.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.47%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	7.63%
Lake	Environmental → Aquatic → Freshwater → Lake	6.78%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.78%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.93%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.24%
Loam	Environmental → Terrestrial → Soil → Loam	4.24%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.24%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.85%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.85%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.85%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.85%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.85%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.85%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.85%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.85%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.85%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.71%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	10.17%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	8.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.47%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	7.63%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	6.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.78%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.93%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	5.08%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.24%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.24%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.54%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.85%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.85%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.85%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.85%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.85%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.85%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.85%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.85%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.85%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.85%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.85%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	6.78%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	6.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.08%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	5.08%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.24%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.24%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.24%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.39%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.54%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.54%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.54%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.69%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.69%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.69%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	1.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	1.69%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.69%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.69%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	1.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.69%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.85%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.85%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.85%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.85%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.85%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.85%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.85%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.85%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.85%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.85%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.85%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.85%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.85%
Aeration Tank Of Activated Sludge Process	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process	0.85%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.85%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908036	Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5	Environmental	Open in IMG/M
2124908044	Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5	Environmental	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000579	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01	Environmental	Open in IMG/M
3300000837	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100	Environmental	Open in IMG/M
3300000893	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001	Environmental	Open in IMG/M
3300004011	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005947	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300007281	Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B	Engineered	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010051	Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196	Engineered	Open in IMG/M
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental	Open in IMG/M
3300010341	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2	Environmental	Open in IMG/M
3300010347	AD_JPHGca	Engineered	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012228	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013503	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M	Environmental	Open in IMG/M
3300013831	Permafrost microbial communities from Nunavut, Canada - A21_5cm_6M	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015080	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300021331	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.456 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025588	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes)	Environmental	Open in IMG/M
3300025703	Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027890	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028770	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4	Environmental	Open in IMG/M
3300029923	II_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029980	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3	Environmental	Open in IMG/M
3300029984	I_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030000	I_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Host-Associated	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031831	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental	Open in IMG/M
3300034129	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16	Environmental	Open in IMG/M
3300034417	Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.52
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.52
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F076350

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
A5_v_00030830	2124908036	Soil	MKEPLSKIVESRYGGRDIPVALVLPDGGRVALSATPEVDVYART
A5_c1_01003840	2124908044	Soil	MGMKEPLSKIVESRYGGRDIPVALVLPDGGRVALSATPEVDVYART
F14TC_1025593141	3300000559	Soil	MAQPLQKIITSRYGGRNLPVTLVLPDGGRVPLSSEPEVEVLART
AP72_2010_repI_A01DRAFT_10659541	3300000579	Forest Soil	MAPPLTKIIASRYSGRNIPIALVLPDGGRVPLSEAPEVDVYARTWQGL
AP72_2010_repI_A100DRAFT_10611312	3300000837	Forest Soil	MAPPLTKIIASRYSGRNIPIALVLPDGGRVPLSEAPEVDVY
AP72_2010_repI_A001DRAFT_10814011	3300000893	Forest Soil	MAPPLTKIIASRYSGRNIPIALVLPDGGRVPLSEAPEVDVYAR
Ga0055460_101508651	3300004011	Natural And Restored Wetlands	MSATMAEPLKRIIAHRYGGRNLPVTLVLPDGGRIPLAPSSDVE
Ga0062590_1017561562	3300004157	Soil	MATMAEPLQKIIASRYGGRDLPVTLVLPDGGRLPLASRTE
Ga0066395_109588532	3300004633	Tropical Forest Soil	MNSLSKMVANRYGGRNLPIALVLPDGGRLALSETPEIDIYARTWSGL
Ga0070683_1020588282	3300005329	Corn Rhizosphere	MTLPLQKIITNRYGGRNVPVTLVLPDGGRVPLSSDPELEILARTWRGLKA
Ga0070675_1000305226	3300005354	Miscanthus Rhizosphere	MTQPLQKIITSRYGGRNLPVTLVLPDGGRVPLSSQPEVEIL
Ga0070671_1011852321	3300005355	Switchgrass Rhizosphere	MTLPLQKIITNRYGGRNLPVTLVLPDGGRVPLSSEPELEVLARTWRG
Ga0070710_106467182	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPEINIYARTWNGLRALA
Ga0066702_104476382	3300005575	Soil	MSRPLTRIIASRYGGRDIPVALVLPDGGRVALSERPE
Ga0068861_1003770793	3300005719	Switchgrass Rhizosphere	MTLPLQKIITNRYGGRNVPVTLVLPDGGRVPLSSDPELEIL
Ga0068862_1001853621	3300005844	Switchgrass Rhizosphere	MTQPLQKIITSRYGGRNLPVTLVLPDGGRVPLSSQPEVEILARTW
Ga0068862_1026563622	3300005844	Switchgrass Rhizosphere	MAEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSNTEIELVA
Ga0066794_100841201	3300005947	Soil	MGMKEPLSKIVESRYGGRNIPVALVLPDGGRVALSATPEVDIYARTWSGVRA
Ga0066696_106250873	3300006032	Soil	MNQPLQKIIASRYSGRDIPIALVLPDGDRVPLSETPEVDVYARTWQGLKTL
Ga0066656_110632992	3300006034	Soil	MTNSLSKMVVNRYGGRNLPIALVLPDGGRLPLSETPEIDVYA
Ga0066652_1002868851	3300006046	Soil	MNQPLQKIIASRYSGRDIPIALVLPDGDRVPLSETPE
Ga0075026_1002368713	3300006057	Watersheds	MPEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSDAEIEILARTW
Ga0070712_1002302623	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPEINIYARTWNGLRA
Ga0079037_1018710992	3300006224	Freshwater Wetlands	MSATMAEPLKRIIANRYGGRNLPVTLVLPDGGRIPLAPQPEVEILA
Ga0068871_1006955313	3300006358	Miscanthus Rhizosphere	MTLPLQKIITNRYGGRNVPVTLVLPDGGRVPLSSDP
Ga0066665_102517791	3300006796	Soil	MNQPLQKIIANRYSGRDIPIALVLPDGDRVPLSETPEVDVYARTWQGLKTLAS
Ga0066660_112745171	3300006800	Soil	MNQPLQKIIANRYSGRDIPIALVLPDGDRVPLSETPEVDVYARTWQGLKTL
Ga0074063_124600823	3300006953	Soil	MAEALQKIIASRYGGRNLPVTLVLPDGGRVPLSSNS
Ga0104349_10364183	3300007281	Aeration Tank Of Activated Sludge Process	MAASLQKIISGRYAGRNGPIALVLPDGGRLALSAAPEVEVVARTWRG
Ga0105238_102746003	3300009551	Corn Rhizosphere	MKQPLQKLIASRYGGRNIPAALVLPDGDRVALSKTPEINI
Ga0126380_104065721	3300010043	Tropical Forest Soil	MKAPLQKIIASRYRDRNLPIALVLPDGGRVPLSETPEIDVYARTFNGLKALAS
Ga0133939_11259152	3300010051	Industrial Wastewater	MAEALQRIITDRYGGRDLPVTLVLPDGARVPLSXXXXXXX
Ga0074046_100493334	3300010339	Bog Forest Soil	MKEPLQRIIAHRYAGRDIPISLVLPDGGRVPLSAAPEVDVYARTWQGLRTLAS
Ga0074045_1000283616	3300010341	Bog Forest Soil	MNAPLQSIIASRYRGRNIPIALVLPDGGRVALSDAPEVDVYART
Ga0116238_101850401	3300010347	Anaerobic Digestor Sludge	MAASLQKIIAGRYAGRNVPIALVLPDGGRLSLSAAPEVEVVARTWRGIN
Ga0134128_121697352	3300010373	Terrestrial Soil	MKQPLQKLIASRYGGRNIPAALVLPDGDRVALSKTPE
Ga0126383_135922181	3300010398	Tropical Forest Soil	MNSSLSKMVASRYSGRNLPIALVLPAGGRLALSETPEIDVYARTW
Ga0105246_115199042	3300011119	Miscanthus Rhizosphere	MTLPLQKIITNRYGGRNVPVTLVLPDGGRVPLSSDPELEILAR
Ga0137389_105994983	3300012096	Vadose Zone Soil	MHQPLQKIIANRYSGRDIPISLVLPDGDRVPLSETPEVDV
Ga0137459_11544642	3300012228	Soil	MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSEPEIEIAARTWRG
Ga0137360_105272912	3300012361	Vadose Zone Soil	MKSVLPKIVANRYGGRNLPIALVLPDGGRVALSASPEI
Ga0164307_106636772	3300012987	Soil	MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPEINIYART
Ga0157374_115029011	3300013296	Miscanthus Rhizosphere	MAPPLKRIIENRYGGKNLPGALVLPAGGGVRLSAA
Ga0157378_104654631	3300013297	Miscanthus Rhizosphere	MAEPLQRIISNRYGGRNLPVTLVLPDGGRVPLSSNAEIEVLARTWRGLK
Ga0157372_120397602	3300013307	Corn Rhizosphere	MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPE
Ga0120127_101718552	3300013503	Permafrost	MVLAPISIMKQPLQKLIASRYGGRNIPVALVLPDGGRGPL
Ga0120126_10005081	3300013831	Permafrost	MKQPLQKLIASRYGGRDIPVALVLPDGGRVALSKTPEINIYAHTW
Ga0157380_109937761	3300014326	Switchgrass Rhizosphere	MPQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSEPEVEILA
Ga0157376_108193381	3300014969	Miscanthus Rhizosphere	MAPPLKRIIENRYGGKNLPVALVLPDGGRVPLSAAPEVDVVA
Ga0167639_10193191	3300015080	Glacier Forefield Soil	MKEPLSKIVESRYGGRDIPVALVLPDGGRVALSATPEVDVYARTW
Ga0132258_102394331	3300015371	Arabidopsis Rhizosphere	MNASLSKIVASRYDGRNIPVALVLPDGGRVALSQPTEVDIYARTWSG
Ga0132258_115182291	3300015371	Arabidopsis Rhizosphere	MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSDPEVEILARTWRGLKAL
Ga0132256_1015270082	3300015372	Arabidopsis Rhizosphere	MAAALKKIIESRYGGRDLPVTLVLPDGGRMALSSRPDL
Ga0132257_1021222441	3300015373	Arabidopsis Rhizosphere	MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSEPEVEILAHTW
Ga0132255_1010300723	3300015374	Arabidopsis Rhizosphere	MNDSLSKIVASRYGGRNIPVALVLPDGGRVALSQPT
Ga0132255_1020399233	3300015374	Arabidopsis Rhizosphere	MAAALKKIIESRYGGRDLPVALVLPDGGRMALSSRPD
Ga0182034_109182452	3300016371	Soil	MAAPLQKIIANRFGGRNLPIALVLPDGARVPLSAD
Ga0190266_104580241	3300017965	Soil	MATPLQSILASRYGGRGIPAALVLPDGGRVALSSSPEIEV
Ga0187787_102334052	3300018029	Tropical Peatland	MKESLQKLIASRYRGRNLPISLVLPDGGRVSLSDTPELDIYARTWEGLKAL
Ga0187773_107789792	3300018064	Tropical Peatland	MSEPLQKIIASRYQGRSLPIVLVLPDGGRVPLSADADIEIIARTWKGLKAL
Ga0184632_104124082	3300018075	Groundwater Sediment	MAEPLRKLIESRYGGRNPPVAPVLSDGGPGALSPTPEG
Ga0184629_103669091	3300018084	Groundwater Sediment	MNQPLQKIIANRYSGRDIPIALVLPDGDRVPLSETPEVDVYARTWQGL
Ga0184629_105818682	3300018084	Groundwater Sediment	MSATMAEPLKKIIANRYGGRNLPVTLVLPDGGRVPLSSEPE
Ga0066667_112072861	3300018433	Grasslands Soil	MSRPLTRIIASRYGGRDIPVALVLPDGGRVALSERPEVDVYARTWRGPKALP
Ga0193729_10726763	3300019887	Soil	MGMKEPLSKIVESRYGGRNIPVAVVLPDGGRVALSAAPEVDVY
Ga0210347_12718132	3300021331	Estuarine	LMAQPLQKIIATRYTGRNLPVTLVLPDGGRVPLSSEPEIEIAAR
Ga0208586_10826902	3300025588	Arctic Peat Soil	MADTLQKIITSRYQGRDIPIALILPGGSRVPLSTT
Ga0208357_10311873	3300025703	Arctic Peat Soil	MAETLQRLIASRYRGRDLPVAVVLPDGGRVALSQS
Ga0207687_106417121	3300025927	Miscanthus Rhizosphere	MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPEINIYARTWNGLR
Ga0207706_103536571	3300025933	Corn Rhizosphere	MTLPLQKIITNRYGGRNVPVTLVLPDGGRVPLSSDPELEILARTWRGLKALS
Ga0207709_101545811	3300025935	Miscanthus Rhizosphere	MPQPLQKIITNRYGGRNLPVTLVLPDGGRVPLSSE
Ga0207669_103004433	3300025937	Miscanthus Rhizosphere	MAEPLQRIISNRYGGRNLPVTLVLPDGGRVPLSSNAEIEVLARTWRGL
Ga0207679_102727413	3300025945	Corn Rhizosphere	MPEALEKVIANRYGGRGLPVAFVLPDGARVKLAPEPE
Ga0207712_110482452	3300025961	Switchgrass Rhizosphere	MPQPLQKIITNRYGGRNLPVTLVLPDGGRVPLSSEPEVEILA
Ga0207639_106752862	3300026041	Corn Rhizosphere	MAEPLKKLITRRYAGRDLPVTLVLPDGGRLPLSPQADIDI
Ga0207678_116044981	3300026067	Corn Rhizosphere	MALPLTSIIASRYAGRELPIALVLPDGGRVALSPKPEVE
Ga0207641_110129162	3300026088	Switchgrass Rhizosphere	MPQPLQKIITNRYGGRNLPVTLVLPDGGRVPLSSEPEVEIL
Ga0207648_110515451	3300026089	Miscanthus Rhizosphere	MKQPLQKLIASRYGGRNIPAALVLPDGDRVALSKTPEINIYA
Ga0209496_102569332	3300027890	Wetland	MAQPLQKIIANRYGGRNLPVTLVLPDGGRVALSSNPEMELLARSWRGLKAL
Ga0268265_124339131	3300028380	Switchgrass Rhizosphere	MAEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSNTEIEL
Ga0302258_11705531	3300028770	Fen	MAEALRHFIASRYDGRNVPVTLVLPDGARLPLSPA
Ga0311347_102792313	3300029923	Fen	MMSEPLQKIIASRYGGRDLPVMLVLPDGGRVPLSSSTEAEIIIRTWRALKAL
Ga0302298_102232332	3300029980	Fen	MMSEPLQKIIASRYGGRDLPVMLVLPDGGRVPLSSSTEAEIIIRTWRALKA
Ga0311332_114085442	3300029984	Fen	MNDSLSRIVANRYGGRNIPVALVLPDGGRVALSEATEVDIYARTWNGLR
Ga0311334_111875771	3300029987	Fen	MMSEPLQKIIASRYGGRDLPVMLVLPDGGRVPLSSSTE
Ga0311336_113610352	3300029990	Fen	MKDSLSRIVANRYGGRNIPVALVLPDGGRVALSEAPEVDIYARTWNGLRA
Ga0311337_115601032	3300030000	Fen	MSEPLQKIIAIRYGGRDLPVMVVLPDGGRVPLSSS
Ga0318534_108064851	3300031544	Soil	MNVPLQKIIASRYRDRNLPIALVLPDGGRVPLSEAPEVDVYARTF
Ga0265313_102745652	3300031595	Rhizosphere	MAQPLQKFIASRYGGRELPVTLILPDGGRVPLSAQPEVE
Ga0306917_100404304	3300031719	Soil	MAAPLQKIIANRFGGRNLPIALVLPDGARVPLSADPEVDVIARSWK
Ga0306917_113297741	3300031719	Soil	MAEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSNVEIEILARTWRGLKA
Ga0307469_102511981	3300031720	Hardwood Forest Soil	MKQPLQKLIASRYGGRNIPAALVLPDGGRVALSKTPEI
Ga0307469_117276861	3300031720	Hardwood Forest Soil	MNQPLQKIIANRYSGRDIPIALVLPDGDRVPLSETPEVDVYAR
Ga0307468_1001602601	3300031740	Hardwood Forest Soil	MAEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSDA
Ga0318564_102863132	3300031831	Soil	MAAPLQKIIANRFGGRNLPIALVLPDGARVPLSADP
Ga0302322_1022403922	3300031902	Fen	MKSSLTRFVAHRYEGRNLPVALVMPDGGRVALSDRPEVDIYART
Ga0310912_1000062417	3300031941	Soil	MKPPLQQIIARRYRDHNLPIALVLPDGGRVPLSETTEVDVYARTWNGLKALAS
Ga0310910_107995692	3300031946	Soil	MNSLPKMVANRYGGRNLPIALVLPDGGRLALSETPEID
Ga0315274_100883095	3300031999	Sediment	MFGALQKIIANRYGGRNLPVTLVLPDGGRVPLSSDAEIEILART
Ga0315274_114049551	3300031999	Sediment	MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSESEIEILARTWRGLKA
Ga0318559_100316124	3300032039	Soil	MKPPLQQIIARRYRDHNLPIALVLPDGGRVPLSETTEVDVYARTW
Ga0315281_116752342	3300032163	Sediment	MMAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSESEIEILARTW
Ga0315268_109108432	3300032173	Sediment	MSATLAEPLKKIIAGRYAGRDLPVTLVLPDGGRLPLSPRTEVDI
Ga0315276_114821062	3300032177	Sediment	MAQPLQKIIASRYTGRNLPVTLVLPGGGRVPLSSKPEIEIAART
Ga0307471_1021416182	3300032180	Hardwood Forest Soil	MKEPLSKIVESRYGGRDIPVAVVLPDGGRVALSPTPEVD
Ga0315271_101816591	3300032256	Sediment	MSATIAEPLRKIIASRYGGRDLPVTLVLPDGGRIPLAP
Ga0315287_110622061	3300032397	Sediment	MAEPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSE
Ga0315287_119363681	3300032397	Sediment	MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSES
Ga0335085_101101195	3300032770	Soil	MKQSLQKIIANRYRGRNLPIALVLPDGGRVPLSEAPELDIYARTWDGLKAL
Ga0316601_1023261571	3300033419	Soil	MSATMAEPLKKIIANRYGGRNLPVTLVLPDGGRIPLAPQAEVEIL
Ga0326726_107125281	3300033433	Peat Soil	MARALQKIIASRYGGRNLPVTLVLPDGGRVPLSAQPEVEIFARSWAGLKALAS
Ga0316627_1000188385	3300033482	Soil	MAQPLQKIIANRYGGRNLPVTLVLPDGGRVALSSNPEMELLA
Ga0316627_1012999252	3300033482	Soil	MSATMAEPLKKIIANRYGGRNLPVTLVLPDGGRIPLAPQAEV
Ga0316621_100916773	3300033488	Soil	MSATMAEPLKKIIANRYGGRNLPVTLVLPDGGRIPLAPQAEVEILARTWRG
Ga0316621_103344102	3300033488	Soil	MAQPLQKIIANRYGGRNLPVTLVLPDGGRVPLSSEPEVEILART
Ga0370493_0029188_1_147	3300034129	Untreated Peat Soil	MKSSLTRFVAHRYEGRNLPVALVMPDGGRVALSDRPEVDIYARTWNGLR
Ga0370493_0147992_633_767	3300034129	Untreated Peat Soil	MKDSLSRIVANRYGGRNIPVALVLPDGGRVALSESPEVDIYARTW
Ga0364941_129242_1_108	3300034417	Sediment	MSYPLQRIIANRYRGRDIPIALVLPDGDRVSLSETP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign