NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078263

Metagenome / Metatranscriptome Family F078263

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078263
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 133 residues
Representative Sequence MELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
Number of Associated Samples 83
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 62.26 %
% of genes near scaffold ends (potentially truncated) 45.69 %
% of genes from short scaffolds (< 2000 bps) 66.38 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.931 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine
(37.069 % of family members)
Environment Ontology (ENVO) Unclassified
(89.655 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(72.414 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 90.65%    β-sheet: 0.00%    Coil/Unstructured: 9.35%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00873ACR_tran 18.10
PF01814Hemerythrin 5.17
PF05494MlaC 3.45
PF00753Lactamase_B 2.59
PF12804NTP_transf_3 1.72
PF12225DUF5981 1.72
PF01594AI-2E_transport 0.86
PF02915Rubrerythrin 0.86
PF13426PAS_9 0.86
PF00211Guanylate_cyc 0.86
PF00365PFK 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG2854Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 3.45
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 0.86
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.86
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.86

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.93 %
UnclassifiedrootN/A12.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000151|SI53jan11_200mDRAFT_c1007405All Organisms → cellular organisms → Bacteria3117Open in IMG/M
3300000151|SI53jan11_200mDRAFT_c1030793All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua913Open in IMG/M
3300000153|SI39nov09_135mDRAFT_c1057343All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua542Open in IMG/M
3300000158|SI54feb11_100mDRAFT_c1048420All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua588Open in IMG/M
3300000160|SI48aug10_135mDRAFT_c1005817All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes2792Open in IMG/M
3300000160|SI48aug10_135mDRAFT_c1036924All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua695Open in IMG/M
3300000171|SI47jul10_200mDRAFT_c1020922All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua756Open in IMG/M
3300000174|SI60aug11_200mDRAFT_c1024480All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1242Open in IMG/M
3300000193|SI47jul10_135mDRAFT_c1002188Not Available7544Open in IMG/M
3300000193|SI47jul10_135mDRAFT_c1003460All Organisms → cellular organisms → Bacteria5557Open in IMG/M
3300000212|SI47jul10_120mDRAFT_c1009560All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua2787Open in IMG/M
3300000213|LP_F_10_SI03_150DRAFT_c1033452All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua711Open in IMG/M
3300000214|SI54feb11_200mDRAFT_c1025836All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua679Open in IMG/M
3300000216|SI53jan11_150mDRAFT_c1003062All Organisms → cellular organisms → Bacteria6876Open in IMG/M
3300000216|SI53jan11_150mDRAFT_c1040516All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua844Open in IMG/M
3300003492|JGI26245J51145_1009565Not Available2160Open in IMG/M
3300003494|JGI26240J51127_1005984All Organisms → cellular organisms → Bacteria3162Open in IMG/M
3300003582|JGI26252J51714_1007827All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes3035Open in IMG/M
3300003582|JGI26252J51714_1010027All Organisms → cellular organisms → Bacteria2592Open in IMG/M
3300003590|JGI26251J51716_1024173All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua687Open in IMG/M
3300003594|JGI26258J51719_1048103All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua569Open in IMG/M
3300003600|JGI26272J51733_1001574All Organisms → cellular organisms → Bacteria8715Open in IMG/M
3300003600|JGI26272J51733_1064536All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Borreliaceae → Borreliella → Borreliella bissettiae530Open in IMG/M
3300003885|Ga0063294_10222978All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1186Open in IMG/M
3300004273|Ga0066608_1127123All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua635Open in IMG/M
3300004274|Ga0066607_1065208All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua947Open in IMG/M
3300004276|Ga0066610_10080496All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1137Open in IMG/M
3300004627|Ga0066629_1165900All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua586Open in IMG/M
3300004636|Ga0066622_1164511All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua597Open in IMG/M
3300004638|Ga0066621_1174486All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua671Open in IMG/M
3300004639|Ga0066620_1230633Not Available1706Open in IMG/M
3300004639|Ga0066620_1249504All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua692Open in IMG/M
3300005233|Ga0066627_1354911Not Available1348Open in IMG/M
3300005351|Ga0074239_106414All Organisms → cellular organisms → Bacteria11117Open in IMG/M
3300005423|Ga0066828_10106325All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300005426|Ga0066847_10131717All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua776Open in IMG/M
3300005604|Ga0066852_10002728All Organisms → cellular organisms → Bacteria7651Open in IMG/M
3300005604|Ga0066852_10003296All Organisms → cellular organisms → Bacteria6953Open in IMG/M
3300005604|Ga0066852_10007117All Organisms → cellular organisms → Bacteria4645Open in IMG/M
3300005838|Ga0008649_10176228All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua841Open in IMG/M
3300007504|Ga0104999_1143034All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua855Open in IMG/M
3300007504|Ga0104999_1159341All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua769Open in IMG/M
3300007504|Ga0104999_1161548All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua758Open in IMG/M
3300007508|Ga0105011_1003089All Organisms → cellular organisms → Bacteria14840Open in IMG/M
3300007765|Ga0105010_1107632All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua867Open in IMG/M
3300008417|Ga0115363_10093698All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua500Open in IMG/M
3300009702|Ga0114931_10414241All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua890Open in IMG/M
3300013098|Ga0164320_10064283All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1526Open in IMG/M
3300013098|Ga0164320_10120115All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1156Open in IMG/M
3300013098|Ga0164320_10403142All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua679Open in IMG/M
3300013099|Ga0164315_10096670All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua2386Open in IMG/M
3300013101|Ga0164313_10585783All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua924Open in IMG/M
3300013101|Ga0164313_11345046All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua576Open in IMG/M
3300020330|Ga0211572_1081050All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua771Open in IMG/M
3300022225|Ga0187833_10462785All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua660Open in IMG/M
3300022227|Ga0187827_10008174All Organisms → cellular organisms → Bacteria11423Open in IMG/M
3300022227|Ga0187827_10068447All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua2750Open in IMG/M
3300022227|Ga0187827_10707532All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua571Open in IMG/M
(restricted) 3300022888|Ga0233428_1001847All Organisms → cellular organisms → Bacteria21516Open in IMG/M
(restricted) 3300022888|Ga0233428_1002561All Organisms → cellular organisms → Bacteria16866Open in IMG/M
(restricted) 3300022888|Ga0233428_1023820All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes2908Open in IMG/M
(restricted) 3300022888|Ga0233428_1034738All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua2228Open in IMG/M
(restricted) 3300022888|Ga0233428_1215383All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua626Open in IMG/M
(restricted) 3300022902|Ga0233429_1130895All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua965Open in IMG/M
(restricted) 3300022916|Ga0233431_1160207All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua927Open in IMG/M
3300023548|Ga0256727_1039541All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1403Open in IMG/M
(restricted) 3300024252|Ga0233435_1104471All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua937Open in IMG/M
(restricted) 3300024252|Ga0233435_1140439All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua751Open in IMG/M
(restricted) 3300024256|Ga0233446_1111003All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua799Open in IMG/M
(restricted) 3300024259|Ga0233437_1157957All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1021Open in IMG/M
(restricted) 3300024260|Ga0233441_1115827All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua893Open in IMG/M
(restricted) 3300024299|Ga0233448_1074902All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua957Open in IMG/M
(restricted) 3300024327|Ga0233434_1182475All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua782Open in IMG/M
3300025422|Ga0209250_1009275All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua2230Open in IMG/M
3300025422|Ga0209250_1075417All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua553Open in IMG/M
3300025452|Ga0209046_1082036All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua588Open in IMG/M
3300025468|Ga0209685_1032711All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1113Open in IMG/M
3300025478|Ga0209576_1036654All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1112Open in IMG/M
3300025488|Ga0209141_1067011All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua767Open in IMG/M
3300025545|Ga0209142_1120632All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua582Open in IMG/M
3300025584|Ga0209774_1049169All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1069Open in IMG/M
3300025584|Ga0209774_1068902All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua862Open in IMG/M
3300025592|Ga0209658_1086182All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua752Open in IMG/M
3300025602|Ga0209361_1091561All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua792Open in IMG/M
3300025614|Ga0209665_1152828All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua577Open in IMG/M
3300025644|Ga0209042_1036928All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1679Open in IMG/M
3300025656|Ga0209054_1113112All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua748Open in IMG/M
3300025659|Ga0209249_1129888All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua713Open in IMG/M
3300025660|Ga0209045_1018815All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua2608Open in IMG/M
3300025660|Ga0209045_1021661All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua2363Open in IMG/M
3300025663|Ga0209775_1141628All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua680Open in IMG/M
3300025709|Ga0209044_1107269All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua854Open in IMG/M
3300026259|Ga0208896_1004512All Organisms → cellular organisms → Bacteria5857Open in IMG/M
3300026259|Ga0208896_1005096All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua5420Open in IMG/M
3300026259|Ga0208896_1198819All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua507Open in IMG/M
3300026261|Ga0208524_1077098All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua920Open in IMG/M
(restricted) 3300027865|Ga0255052_10165578All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1080Open in IMG/M
(restricted) 3300027872|Ga0255058_10499715All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua594Open in IMG/M
(restricted) 3300027997|Ga0255057_10253288All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua854Open in IMG/M
(restricted) 3300027997|Ga0255057_10416951All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua651Open in IMG/M
3300028174|Ga0257123_1020659All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1957Open in IMG/M
3300028174|Ga0257123_1107988All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua626Open in IMG/M
3300028175|Ga0257117_1028786All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1676Open in IMG/M
3300028277|Ga0257116_1019827All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua → Candidatus Scalindua brodae2350Open in IMG/M
3300028277|Ga0257116_1050271All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua1237Open in IMG/M
3300028706|Ga0257115_1085572All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua849Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine37.07%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater16.38%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.76%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine5.17%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment5.17%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.45%
Water ColumnEnvironmental → Aquatic → Marine → Coastal → Unclassified → Water Column2.59%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater2.59%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.72%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.86%
Hydrothermal Fe-Rich MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat0.86%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents0.86%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.86%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.86%
BioreactorEngineered → Wastewater → Nutrient Removal → Nitrogen Removal → Anammox → Bioreactor0.86%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000151Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 200mEnvironmentalOpen in IMG/M
3300000153Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 135mEnvironmentalOpen in IMG/M
3300000158Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 100mEnvironmentalOpen in IMG/M
3300000160Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 48 08/11/10 135mEnvironmentalOpen in IMG/M
3300000171Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 200mEnvironmentalOpen in IMG/M
3300000174Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 200mEnvironmentalOpen in IMG/M
3300000193Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 135mEnvironmentalOpen in IMG/M
3300000212Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 120mEnvironmentalOpen in IMG/M
3300000213Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_150EnvironmentalOpen in IMG/M
3300000214Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 200mEnvironmentalOpen in IMG/M
3300000216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 150mEnvironmentalOpen in IMG/M
3300003492Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_200m_DNAEnvironmentalOpen in IMG/M
3300003494Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNAEnvironmentalOpen in IMG/M
3300003582Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_10m_DNAEnvironmentalOpen in IMG/M
3300003590Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_200m_DNAEnvironmentalOpen in IMG/M
3300003594Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_10m_DNAEnvironmentalOpen in IMG/M
3300003600Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_120m_DNAEnvironmentalOpen in IMG/M
3300003885Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1EnvironmentalOpen in IMG/M
3300004273Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_135mEnvironmentalOpen in IMG/M
3300004274Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_120mEnvironmentalOpen in IMG/M
3300004276Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165mEnvironmentalOpen in IMG/M
3300004278Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150mEnvironmentalOpen in IMG/M
3300004627Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI054_200m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI048_150m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004638Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI048_135m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004639Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI048_120m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005233Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI054_135m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005351Bioreactor Anammox bacterial community from Nijmegen, The Netherlands - Scalindua species enirchmentEngineeredOpen in IMG/M
3300005423Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47EnvironmentalOpen in IMG/M
3300005426Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74EnvironmentalOpen in IMG/M
3300005604Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63EnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300007504Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300007508Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300007765Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 2.7-0.2um, replicate bEnvironmentalOpen in IMG/M
3300008417Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12TEnvironmentalOpen in IMG/M
3300009702Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaGEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300013099Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300020330Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX556097-ERR599147)EnvironmentalOpen in IMG/M
3300022225Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022227Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022888 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_120_MGEnvironmentalOpen in IMG/M
3300022902 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MGEnvironmentalOpen in IMG/M
3300022912 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_150_MGEnvironmentalOpen in IMG/M
3300022916 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_200_MGEnvironmentalOpen in IMG/M
3300023548Hydrothermal Fe-rich mat microbial community from Loihi Seamount, Hawaii, USA - 677-SSYellowEnvironmentalOpen in IMG/M
3300024243 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_150_MGEnvironmentalOpen in IMG/M
3300024252 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_135_MGEnvironmentalOpen in IMG/M
3300024256 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_120_MGEnvironmentalOpen in IMG/M
3300024259 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MGEnvironmentalOpen in IMG/M
3300024260 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MGEnvironmentalOpen in IMG/M
3300024299 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_150_MGEnvironmentalOpen in IMG/M
3300024302 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_200_MGEnvironmentalOpen in IMG/M
3300024327 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_120_MGEnvironmentalOpen in IMG/M
3300025422Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_200m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025431Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025452Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_200m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025458Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_110m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025468Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_120m (SPAdes)EnvironmentalOpen in IMG/M
3300025478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_135m (SPAdes)EnvironmentalOpen in IMG/M
3300025488Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025545Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025584Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025592Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025602Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_200m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025614Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_200m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025644Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_200m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025656Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_200m (SPAdes)EnvironmentalOpen in IMG/M
3300025659Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_200m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025660Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025663Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_135m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025709Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026259Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 (SPAdes)EnvironmentalOpen in IMG/M
3300026261Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 (SPAdes)EnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300027872 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028174Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_135EnvironmentalOpen in IMG/M
3300028175Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_135mEnvironmentalOpen in IMG/M
3300028277Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_120mEnvironmentalOpen in IMG/M
3300028706Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_100mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SI53jan11_200mDRAFT_100740523300000151MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD*
SI53jan11_200mDRAFT_103079323300000151MarineMELLHDSDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVASSVKEHDETIKKLEERTMSKFAEMTAQIEVMVSDKHKNIVSKINDISSRVDNLEEKIDLAVRELKS
SI39nov09_135mDRAFT_105734323300000153MarineLEGSLDCQLKRLEEKIETSQPVALMKXLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVR
SI54feb11_100mDRAFT_104842013300000158MarineMEVFVMELLHDSDGLEGSLDCQLKRLEEKIETXQPVALMKXLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVTDKHNDLISKINGISSRVDNLEEKI
SI48aug10_135mDRAFT_100581723300000160MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVTDKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
SI48aug10_135mDRAFT_103692413300000160MarineLVGSLDCQLKRLEEKIDTSQPIALLKDLHRQDDEIRHFKNVETTMNTVASSVKELDGTIRKLEERTGSKFTEMTSQIKVTEAMVADKHKGLISKINNINSRIDNLEKKIDFAVRELKSETRKTSFLRKLLWLD*
SI47jul10_200mDRAFT_102092213300000171MarineMEVFVMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVTDKHNDLISKINGISSRVDNLEEKIEL
SI60aug11_200mDRAFT_102448033300000174MarineLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD*
SI47jul10_135mDRAFT_1002188113300000193MarineSQPIALLKDLHRQDDEIRHFKNVETTMNTVASSVKELDGTIRKLEERTGSKFTEMTSQIKVTEAMVADKHKGLISKINNINSRIDNLEKKIDFAVRELKSETRKTSFLRKLLWLD*
SI47jul10_135mDRAFT_100346023300000193MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD*
SI47jul10_120mDRAFT_100956013300000212MarineMELLHDSDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAV
LP_F_10_SI03_150DRAFT_103345213300000213MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPIALLKDLHRQDDEIRHFKNVETTMNTVASSVKELDGTIRKLEERTGSKFTEMTSQIKVTEAMVADKHKGLISKINNINSRIDN
SI54feb11_200mDRAFT_102583613300000214MarineFLFRYSRRYFGMELLHDSDELVGSLDCQLKRLEEKIDTSQPIALLKDLHRQDDEIRHFKNVETTMNTVASSVKELDGTIRKLEERTGSKFTEMTSQIKVTEAMVADKHKGLISKINNINSRIDNLEKKIDFAVRELKSETRKTSFL
SI53jan11_150mDRAFT_100306213300000216MarineKYKRETKALLFIPIFKEEFKMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD*
SI53jan11_150mDRAFT_104051613300000216MarineMELLHDSDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD*
JGI26245J51145_100956543300003492MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
JGI26240J51127_100598413300003494MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
JGI26252J51714_100782723300003582MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTMSKFVEMTAQIEVVVSDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD*
JGI26252J51714_101002723300003582MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPIALLKDLHRQDDEIRHFKNVETTMNTVASSVKELDGTIRKLEERTGSKFTEMTSQIKVTEAMVADKHKGLISKINNINSRIDNLEKKIDFAVRELKSETRKTSFLRKLLWLD*
JGI26251J51716_101552213300003590MarineMELLHDSDGLEGSLDCQLKRLEEKIETXQPVALMKXLHRIDDEIKHFKDVEITTNTVVSSVKEHXETIKKLEERTRDKFAEMTSQNKATEAMVTDKHN
JGI26251J51716_102417313300003590MarineELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
JGI26258J51719_104810313300003594MarineNALLFLSIFMEVFVMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVFNI*
JGI26272J51733_100157413300003600MarineMELLHDSDGLEGSLDCQLKRLEEKIETXQPVALMKXLHRIDDEIKHFKDVEITTNTVVSSVKEHXETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
JGI26272J51733_106453613300003600MarineLKRLEEKIDTSQPIALLKDLHRQDDEIRHFKNVETTMNTVASSVKELDGTIRKLEERTGSKFTEMTSQIKVTEAMVADKHKGLISKINNINSRIDNLEKKIDFAVRELKSETRKTSFLRKLLWLD*
Ga0063294_1022297813300003885Hydrothermal VentsVVWVESWHIYCEMQVLKALLFLPIDKEVLGVDLLHDSSGLVGSLDCQLKRLEEKIDTSRPVALMKDLHRQDETIKKLEERTKNKCTEMTSQIKATEVMVADKHTDLICKINDISSRIDNLEKKIDLAVRELKSEARKTSFLRKLLWLD*
Ga0066608_112712313300004273MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLA
Ga0066607_106520813300004274MarineMELLHDSDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDKLEEKIDLAVRELKSEARKTSVLRKLLWLD*
Ga0066610_1008049623300004276MarineMELLHDSDDLVGSLDCQLKRLEEKIDKIQPAALVKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKNLEERTKNKFAEMTAQIEAMVDDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD*
Ga0066609_1000879813300004278MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMV
Ga0066629_116590013300004627MarineMEVFVMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
Ga0066622_116451113300004636MarineNALLFLSIFMEVFVMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEESIKKLEERTRDKFAEMTSQNKATEAMVTDKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
Ga0066621_117448613300004638MarineALLFLSIFMEVFVMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
Ga0066620_123063333300004639MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEESIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
Ga0066620_124950413300004639MarineMELLHDSDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDKLEEKIDLAVRELKSEARKTSVLRKLLWLD*
Ga0066627_135491113300005233MarineNALLFLSIFMEVFVMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
Ga0074239_10641463300005351BioreactorMELLHDSEELVGSLDCQLKRLEEKIDTSQSVELMKDLHRMDDEIRHFKDVEITTNSVVSSVNKQGETIKKIEEGTRNKFTEMTSQMKSTEAMVADKHKNLISKINGISSRVDSLEEKIDLAVRELKSEARKTSVLRKLLWLD*
Ga0066828_1010632523300005423MarineMELLHDSDELAGSLDCQLKRLEEKIDTSRPAALAKDIHRIEDEIRYFKDVEITTNAVVSSVKEHDGTIKKLEERTSNKFVEMIAQIETMKAMVADKHKDLISKINDISSRVDNLEEKIELAV
Ga0066847_1013171713300005426MarineMGLLHDGDELEGSLDCQLKRLEKKIDTSQPAALVKDIHRIEDEIRHFKDVEVTTNTVVSSVKEHDETIKKLEERTSNKFAEMIAQIEAMKAMAADKHKDLISKINDISSRVDNLEEKIELAVRELKSEARKTSVLRKLLWLD*
Ga0066852_1000272863300005604MarineMELLHDSDELVGSLDSQLKRLEEKIDTIQPATLVKDIHRIDDEIRHFKDVEITTNTVVSSVKEHDETIKKLEERTSNKFVEMTAQIEAIVADKHKDLVSKINDISNRVNNLDEKIELAVRELKAEARKTSVLRKLLWLD*
Ga0066852_1000329653300005604MarineMGLLHDGDELEGSLDCQLKRLEKKIDTSQPAALVKDIHWIEDEIRHFKDVEVTTNTVVSSVKEHDGTIKKLEERTSNKFAEMIAQIEAMKAMAADKHKDLISKINDISSRVDNLEEKIELAVRELKSE
Ga0066852_1000711723300005604MarineMELLHDGDELVGSLDCQLKHLEEKIDTSQSTALVKDIHRIEDEIRHFKDVEITTNTIVSSVKEHDETFKKLEERTSNKFAEMIAQIETMKAMVADKHKDLISKINDISSRVDNLEEKIELAVRELKSEARKTSVLRKLLWLD*
Ga0008649_1017622813300005838MarineMELLHDSDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVD
Ga0104999_114303413300007504Water ColumnMELLHDSDELVGSLDSQLKRLEEKIDTIQPATLVKDIHRIDDEIRHFKDVEITTNTVVSSVKEHDETIKKLEERTSNKFVEMTAQIEAIVADKHKDLVSKINDISNRVNNLDEKIELAVRELKSEARKTSVLRKLLWLD*
Ga0104999_115934113300007504Water ColumnMELLHDSDELVGSLDSQLKRLEEKIDTIQPATLVKDIHRIDDEIKHFKDVELTTNTVVSSVKEHDETIKKLEERTSNKFVEMTAQIEAIVADKHKDLVSKINDISSRVNNLD
Ga0104999_116154813300007504Water ColumnMELLHDSDELVGTLDSQLKRLEEKIDTIQPATLVKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTSNKFVEMTAQIEAIVADKHKDLVSKINDISSRVNNLD
Ga0105011_1003089103300007508MarineMELLHDSDELVGSLDSQLKRLEEKIDTIQPATLVKDIHRIDDEIRHFKDVEITTNTVVSSVKEHDETIKKLEERTSNKFVEMTAQIEAIVADKHKDLVSKINDISSRVNNLDEKIELAVRELKSEARKTSVLRKLLWLD*
Ga0105010_110763213300007765MarineMELLHDSDELVGSLDSQLKRLEEKIDTIQPATLVKDIHRIDDEIKHFKDVELTTNTVVSSVKEHDETIKKLEERTSNKFVEMTAQIEAIVADKHKDLVSKINDISSRVNNLDEKIELAVRELKSEARKTSVLRKLLWLD*
Ga0115363_1009369813300008417SedimentMELLHDSSGLVGSLDCQLKRLEEKIDTNRPVELMKDLRRLDDEIRHFKDVEITTNTVVSSVKELGETIKELEERTRNKFTVMTSQIKATEAMVADKHKDLISKINDISSRIDNLEKKIDI
Ga0114931_1041424113300009702Deep SubsurfaceMAHLLRNVVFKKALLFLPIFKEVLGMELLHDSGGLVGSLDCQLKRLEEKIDTSRPVALMKDLHRLDDEIRHFKDVEITTNTVVSSVREQNETIQRLEEKTRNKYTEMASQIRATEVIVADKHKDLISKINDISSRIDNLEKKIDLAVRELKSEARKTSFLRKLLWLD*
Ga0164320_1006428313300013098Marine SedimentVLKDLLFLPIFKEVLGMELLHDSSGLVGSLNCQLKRLENKIDTSRSVALMKDLHRLDETIKKLEERTRNKLTEITSQIKGMEAMVDGKHKGLISKINDISSRIDNLEKKIDLAVRELKSEARKTSFLRKLLWLD*
Ga0164320_1012011513300013098Marine SedimentMELLHDSDELVGSLDCQLKRLEEKIDTIQPATLVKDIHRIDDEIRHFKDVEITTNTVVSSVKEHDETIKKLEERTRNKFAEMTAQIEAMVADKHKDLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD*
Ga0164320_1040314213300013098Marine SedimentVLNLSLKALLFFPIFNEVFGMELLHDSEGLAGSLDCQLKRLEEKIDTSQPVALMKDLHRMDDEIRHFKDVEITTNTVVSSVKEHDETIKKLEERTSDKFTEMTSQYKATEAMVADKHKDLISKINDISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD*
Ga0164315_1009667023300013099Marine SedimentVLKDLLFLPIFKEVLGMELLHDSSGLVGSLNCQLKRLENKIDTSRSVALMKDLHRLDETIKKLEERTRNKLTEITSQIKGTEAMVDGKHKGLISKINDISSRIDNLEKKIDLAVRELKSEARKTSFLRKLLWLD*
Ga0164313_1058578313300013101Marine SedimentMELLHDSDDLVGKLDCQLKRLEEKIDTSQPAAIMKDLHRMDDEIKHLKDVKKTTKTVVSSVKEQDETIKKLVSKINDICSRVDNLEEKINLAVRELKSEARKTSVLRKLLWLD*
Ga0164313_1134504613300013101Marine SedimentVLKDLLFLPIFKEVLGMELLHDSSGLVGSLNCQLKRLENKIDTSRSVALMKDLHRLDETIKKLEERTRNKLTEITSQIKGTEAMVDGKHKGLISKINDISSRIDNLEKKIDL
Ga0211572_108105023300020330MarineMGLLHDGDELEGSLDCQLKRLEKKIDTSQPAALVKDIHWIEDEIRHFKDVEVTTNTVVSSVKEHDRTIKKLEERTSNKFVEMIAQIETMKAMVADKHKDLISKINDISSRVDNLEEKIE
Ga0187833_1046278523300022225SeawaterTSQSTALVKDIHRIEDEIRHFKDVEITTNTIVSSVKEHDETFKKLEERTSNKFAEMIAQIETMKAMVADKHKDLISKINDISSRVDNLEEKIELAVRELKSEARKTSVLRKLLWLD
Ga0187827_1000817463300022227SeawaterMELLHDSDELAGSLDCQLKRLEEKIDTSRPAALAKDIHRIEDEIRYFKDVEITTNAVVSSVKEHDGTIKKLEERTSNKFVEMIAQIETMKAMVADKHKDLISKINDISSRVDNLEEKIELAVRELKSEARKTSVLRKLLWLD
Ga0187827_1006844713300022227SeawaterMGLLHDGDELEGSLDCQLKRLEKKIDTSQPAALVKDIHWIEDEIRHFKDVEVTTNTVVSSVKEHDRTIKKLEERTSNKFAEMIAQIEAVKAMAADKHKDLISKINDISSRVDNLEEKIELAVRELKSEARKTSVLRKLLWLD
Ga0187827_1070753213300022227SeawaterMELLHDSDELVGSLDSQLKRLEEKIDTIQPATLVKDIHRIDDEIRHFKDVEITTNTVVSSVKEHDETIKKLEERTSNKFVEMTAQIEAIVADKHKDLVSKINDISSRVDNLDEKIELAVRELKSEARKTSVLRKLLWLD
(restricted) Ga0233428_1001847193300022888SeawaterMELLHDSDELVGSLDCQLKRLEEKIDTSQPIALLKDLHRQDDEIRHFKNVETTMNTVASSVKELDGTIRKLEERTGSKFTEMTSQIKVTEAMVADKHKGLISKINNINSRIDNLEKKIDFAVRELKSETRKTSFLRKLLWLD
(restricted) Ga0233428_1002561163300022888SeawaterMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD
(restricted) Ga0233428_102382023300022888SeawaterMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIRNLEERTKNKFAEMTAQIEAMVAGKHNNLVSKINDISSRVDNLEEKIDLAVRELKSESRKTSVLRKLLWLD
(restricted) Ga0233428_103473823300022888SeawaterMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDKLEEKIDLAVRELKSEARKTSVLRKLLWLD
(restricted) Ga0233428_121538323300022888SeawaterRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
(restricted) Ga0233429_113089513300022902SeawaterFKEEFKMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDKLEEKIDLAVRELKSEARKTSVLRKLLWLD
(restricted) Ga0233430_100493813300022912SeawaterMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISS
(restricted) Ga0233430_122808813300022912SeawaterMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRTDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISS
(restricted) Ga0233431_116020723300022916SeawaterMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD
Ga0256727_103954113300023548Hydrothermal Fe-Rich MatMELLHDSSGLVGSLDCQLKRLEEKIDTSRPVALMKDLHRLDDEIRHFKDVEITTNTVVSSVKEQNETIQRLEEKTRNKYTEMASQIRETEVIVADKHKDVVSKINDISSRIDNLEKKIDSAVRELKSEARKTSFLRKLLWLD
(restricted) Ga0233436_108695713300024243SeawaterMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGIS
(restricted) Ga0233435_110447113300024252SeawaterDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
(restricted) Ga0233435_114043913300024252SeawaterAHLLQIKSKKRNNALLFLSIFMEVFVMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD
(restricted) Ga0233446_111100313300024256SeawaterKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD
(restricted) Ga0233437_115795723300024259SeawaterMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDEAIKKLEERTRSKFAEMTAQIEAMDADKHRNIVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
(restricted) Ga0233441_111582723300024260SeawaterMELLHDSDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDKLEEKIDLAVRELKSEARKTSVLRKLLWLD
(restricted) Ga0233448_107490213300024299SeawaterMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
(restricted) Ga0233449_119397413300024302SeawaterMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGI
(restricted) Ga0233434_118247513300024327SeawaterMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEESIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD
Ga0209250_100927523300025422MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0209250_107541713300025422MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPIALLKDLHRQDDEIRHFKNVETTMNTVASSVKELDGTIRKLEERTGSKFTEMTSQIKVTEAMVADKHKGLISKINNINSRIDNLEKKIDFAVRELKSETRKTSFLRK
Ga0209449_102573813300025431MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVTDKHNDL
Ga0209046_108203613300025452MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFL
Ga0209559_101533523300025458MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVTDKHNDLISKING
Ga0209685_103271133300025468MarineIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD
Ga0209576_103665413300025478MarineKEKQKLCFSIPIFKEAFEMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0209576_109293513300025478MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVTDKHN
Ga0209141_106701113300025488MarineMELLHDSDDLVGSLDCQLKRLEEKIDTIQPAALVKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWL
Ga0209142_112063213300025545MarineTSQTAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0209774_104916923300025584MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVTDKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD
Ga0209774_106890223300025584MarineYKRETKALLFIPIFKEEFKMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVASSVKEHDETIKKLEERTMSKFAEMTAQIEVMVSDKHKNIVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0209658_108618223300025592MarineCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVASSVKEHDETIKKLEERTMSKFAEMTAQIEVMVSDKHKNIVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0209361_109156123300025602MarineFRSIKRNKRFTFIPIFKEAFEMELLHDSDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDKLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0209665_115282813300025614MarineRNNALLFLSIFMEVFVMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD
Ga0209042_103692823300025644MarineMELLHDSDDLVGSLDCQLKRLEEKIDTIQPAALVKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKNLEERTKNKFAEMTAQIEAMVDDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0209054_111311213300025656MarineKRNNALLFLSIFMEVFVMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD
Ga0209249_112248613300025659MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISS
Ga0209249_112988813300025659MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSESRKTSVLRKLLW
Ga0209045_101881513300025660MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVASSVKEHDETIKKLEERTMSKFAEMTAQIEVMVSDKHKNIVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0209045_102166113300025660MarineKIDTSQTAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDKLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0209775_114162813300025663MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVTDKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLL
Ga0209044_110726923300025709MarineMELLHDSDGLEGSLDCQLKRLEEKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRDKFAEMTSQNKATEAMVADKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLL
Ga0208896_100451213300026259MarineLFLPIFKEVLGMELLHDGDELVGSLDCQLKHLEEKIDTSQSTALVKDLHRIEDEIRHFKDVEITTNTIVSSVKEHDETFKKLEERTSNKFAEMIAQIETMKAMVADKHKDLISKINDISSRVDNLEEKIELAVRELKSEARKTSVLRKLLWLD
Ga0208896_100509633300026259MarineMELLHDSDELVGSLDSQLKRLEEKIDTIQPATLVKDIHRIDDEIRHFKDVEITTNTVVSSVKEHDETIKKLEERTSNKFVEMTAQIEAIVADKHKDLVSKINDISNRVNNLDEKIELAVRELKAEARKTSVLRKLLWLD
Ga0208896_119881913300026259MarineMGLLHDGDELEGSLDCQLKRLEKKIDTSQPAALVKDIHRIEDEIRHFKDVEVTTNTVVSSVKEHDGTIKKLEERTSNKFAEMIAQIEAMKAMAADKHKDLISKINDISSRVDNLEEKIELAVRGLKSEAIKTSALRKLLWLD
Ga0208524_107709813300026261MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALVKDIHRIEDEIRHFKDVEVTTNTVVSSVKEHDGTIKKLEERTSNKFVEMTAQIETMKAIVSDKHKDLISKMNDISSRVDNLEEKIELAVRELKSEARKTSVLRKLLWLD
(restricted) Ga0255052_1016557813300027865SeawaterMELLHDSSGLVGSLDCQLKRLEEKIDTSRSVALMKDLHRLDDEIRHFKDVEITTNTVVSSVKELDETIKKLEERTRNKFTEMTSQIKATEAMVADKHKDLISKINDMNSRIDVLEKKIDLAVRELKSEARKTSFLRKLLWLD
(restricted) Ga0255058_1049971523300027872SeawaterDCQLKRLEKKIDTSQPIALMKDLHRLGDEIRHFKDVEITTNKVVSSVEEQDETIKKLEERTRNKLTEMTSQIKGTEAMVDGKHKGLIAKINDISSRIDNLEKKIDLAVRELKSEARKTSFLRKLLWLD
(restricted) Ga0255057_1025328813300027997SeawaterMELLHDSDGLAGSLDCQLKRLEEKIDTSQPVALMKDLHRMDDEIRHFKDVEITTNTVVSSVKEHDETIKKLEERISDKFTEMTSQYKATEAMVADKHKDLISKINDISSRVDNLEEKIELAVRELKSEARKTSFLRKLLW
(restricted) Ga0255057_1041695113300027997SeawaterMELLHDSSGLVGSLNCQLKRLENKIDTSRTVALMKDLHRLDETIKKLEERTRNKLTEITSQIKGTEAMVDGKHKGLISKINDISSRIDNLEKKIDLAVRELKSEARKTSFLRKLLWLD
Ga0257123_102065943300028174MarineMELLHDSDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0257123_110798823300028174MarineFEMELLHDSDQLVGSLDCQLKRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIRNLEERTKNKFAEMTAQIEAMVAGKHNNLVSKINDISSRVDNLEEKIDLAVRELKSESRKTSVLRKLLWLD
Ga0257117_102878613300028175MarineEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDKLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0257116_101982713300028277MarineRLEEKIDTSQPAALMKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFVEMTAQIEAVVTDKHKNLVSKINDISSRVDKLEEKIDLAVRELKSEARKTSVLRKLLWLD
Ga0257116_105027133300028277MarineKIETSQPVALMKDLHRIDDEIKHFKDVEITTNTVVSSVKEHEETIKKLEERTRDKFAEMTSQNKATEAMVTDKHNDLISKINGISSRVDNLEEKIELAVRELKSEARKTSFLRKLLWLD
Ga0257115_108557223300028706MarineMELLHDSDELVGSLDCQLKRLEEKIDTSQPAALVKDIHRIDDEIKHFKDVEITTNTVVSSVKEHDETIKKLEERTRHKFAEMTAQIEAVVTDKHKNLVSKINDISSRVDNLEEKIDLAVRELKSEARKTSVLRKLLWLD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.