NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080016

Metagenome / Metatranscriptome Family F080016

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080016
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 47 residues
Representative Sequence MTGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRL
Number of Associated Samples 108
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 39.47 %
% of genes near scaffold ends (potentially truncated) 98.26 %
% of genes from short scaffolds (< 2000 bps) 90.43 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.783 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(11.304 % of family members)
Environment Ontology (ENVO) Unclassified
(34.783 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.217 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF11706zf-CGNR 7.83
PF01522Polysacc_deac_1 4.35
PF02583Trns_repr_metal 3.48
PF00248Aldo_ket_red 2.61
PF01833TIG 2.61
PF03631Virul_fac_BrkB 2.61
PF07336ABATE 2.61
PF12697Abhydrolase_6 2.61
PF00702Hydrolase 1.74
PF09922DUF2154 1.74
PF05437AzlD 1.74
PF00072Response_reg 0.87
PF06441EHN 0.87
PF03364Polyketide_cyc 0.87
PF06480FtsH_ext 0.87
PF01569PAP2 0.87
PF00027cNMP_binding 0.87
PF09754PAC2 0.87
PF14333DUF4389 0.87
PF04337DUF480 0.87
PF01694Rhomboid 0.87
PF00211Guanylate_cyc 0.87
PF13692Glyco_trans_1_4 0.87
PF02776TPP_enzyme_N 0.87
PF03706LPG_synthase_TM 0.87
PF09880DUF2107 0.87
PF12681Glyoxalase_2 0.87
PF10282Lactonase 0.87
PF13683rve_3 0.87
PF11139SfLAP 0.87
PF00484Pro_CA 0.87
PF13539Peptidase_M15_4 0.87
PF13240zinc_ribbon_2 0.87
PF04350PilO 0.87
PF02515CoA_transf_3 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 4.35
COG1937DNA-binding transcriptional regulator, FrmR familyTranscription [K] 3.48
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 2.61
COG5516Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-bindingGeneral function prediction only [R] 2.61
COG3167Type IV pilus assembly protein PilOCell motility [N] 1.74
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.87
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.87
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 0.87
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.87
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.87
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.87
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.87
COG3132Uncharacterized conserved protein YceH, UPF0502 familyFunction unknown [S] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.78 %
UnclassifiedrootN/A25.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2065487018|GPINP_F5MS3JC02H3JYMNot Available506Open in IMG/M
3300000956|JGI10216J12902_102127675Not Available610Open in IMG/M
3300004081|Ga0063454_102030700Not Available509Open in IMG/M
3300004114|Ga0062593_101306732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300004156|Ga0062589_101970125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300005093|Ga0062594_100481408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1041Open in IMG/M
3300005332|Ga0066388_102882807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300005333|Ga0070677_10873759Not Available518Open in IMG/M
3300005334|Ga0068869_101159552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300005338|Ga0068868_100430586All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300005340|Ga0070689_100123464Not Available2070Open in IMG/M
3300005355|Ga0070671_100330119Not Available1300Open in IMG/M
3300005406|Ga0070703_10042502Not Available1421Open in IMG/M
3300005434|Ga0070709_11037327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300005435|Ga0070714_102330159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales521Open in IMG/M
3300005445|Ga0070708_100210728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1820Open in IMG/M
3300005451|Ga0066681_10734869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300005471|Ga0070698_100303302All Organisms → cellular organisms → Bacteria → Terrabacteria group1528Open in IMG/M
3300005544|Ga0070686_100403070All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300005553|Ga0066695_10661495Not Available617Open in IMG/M
3300005558|Ga0066698_10764365All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005563|Ga0068855_101198521All Organisms → cellular organisms → Bacteria → Terrabacteria group790Open in IMG/M
3300005569|Ga0066705_10152647All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300005598|Ga0066706_10959859All Organisms → cellular organisms → Bacteria → Terrabacteria group662Open in IMG/M
3300005614|Ga0068856_102560342Not Available516Open in IMG/M
3300005718|Ga0068866_10698279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300006028|Ga0070717_12004528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300006034|Ga0066656_10375507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium919Open in IMG/M
3300006042|Ga0075368_10204293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium836Open in IMG/M
3300006058|Ga0075432_10189723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300006574|Ga0074056_11791162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1589Open in IMG/M
3300006576|Ga0074047_11579075All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300006755|Ga0079222_10592828All Organisms → cellular organisms → Bacteria → Terrabacteria group844Open in IMG/M
3300006791|Ga0066653_10051789Not Available1712Open in IMG/M
3300006791|Ga0066653_10135863Not Available1176Open in IMG/M
3300006796|Ga0066665_11404739All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax gelatinosus540Open in IMG/M
3300006797|Ga0066659_10202100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1455Open in IMG/M
3300006854|Ga0075425_101400510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium791Open in IMG/M
3300009147|Ga0114129_10226241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2521Open in IMG/M
3300009147|Ga0114129_10969330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1073Open in IMG/M
3300009162|Ga0075423_11784507Not Available663Open in IMG/M
3300009162|Ga0075423_12909580Not Available525Open in IMG/M
3300009176|Ga0105242_10073174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2848Open in IMG/M
3300009177|Ga0105248_11288776All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300010048|Ga0126373_11593135All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium718Open in IMG/M
3300010227|Ga0136219_1019129Not Available752Open in IMG/M
3300010325|Ga0134064_10239416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300010336|Ga0134071_10451319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300010401|Ga0134121_11127870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria779Open in IMG/M
3300010403|Ga0134123_11642843Not Available692Open in IMG/M
3300011107|Ga0151490_1765812Not Available588Open in IMG/M
3300011119|Ga0105246_12042002All Organisms → cellular organisms → Bacteria → Terrabacteria group554Open in IMG/M
3300011269|Ga0137392_11198195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300012010|Ga0120118_1077265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300012204|Ga0137374_10827298All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300012208|Ga0137376_10295057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1407Open in IMG/M
3300012208|Ga0137376_10725609All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300012209|Ga0137379_11183573All Organisms → cellular organisms → Bacteria → Terrabacteria group671Open in IMG/M
3300012210|Ga0137378_10018137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales6147Open in IMG/M
3300012211|Ga0137377_11944797Not Available505Open in IMG/M
3300012350|Ga0137372_11083786All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300012353|Ga0137367_10766606All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300012357|Ga0137384_11051658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300012960|Ga0164301_11761717All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012960|Ga0164301_11841625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300012961|Ga0164302_10943798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300012976|Ga0134076_10405966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300012985|Ga0164308_10841348All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300012986|Ga0164304_10564061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300012989|Ga0164305_10313192All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300013100|Ga0157373_11216522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300013102|Ga0157371_10387085Not Available1022Open in IMG/M
3300013297|Ga0157378_12599525Not Available559Open in IMG/M
3300015359|Ga0134085_10551173All Organisms → cellular organisms → Bacteria → Terrabacteria group532Open in IMG/M
3300015372|Ga0132256_103245462All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300016294|Ga0182041_10845864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300016371|Ga0182034_11323144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300016445|Ga0182038_10578161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria967Open in IMG/M
3300017944|Ga0187786_10479813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300017947|Ga0187785_10669047Not Available542Open in IMG/M
3300018064|Ga0187773_10035255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2230Open in IMG/M
3300018089|Ga0187774_10090540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1481Open in IMG/M
3300018433|Ga0066667_10056620All Organisms → cellular organisms → Bacteria2399Open in IMG/M
3300018433|Ga0066667_11565795Not Available585Open in IMG/M
3300018468|Ga0066662_12025584Not Available603Open in IMG/M
3300021413|Ga0193750_1017337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1755Open in IMG/M
3300025899|Ga0207642_10193579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1118Open in IMG/M
3300025910|Ga0207684_10977430Not Available709Open in IMG/M
3300025911|Ga0207654_10332900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300025914|Ga0207671_11451022All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300025915|Ga0207693_10132812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1957Open in IMG/M
3300025929|Ga0207664_10508319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1079Open in IMG/M
3300025949|Ga0207667_12032011Not Available534Open in IMG/M
3300026121|Ga0207683_10025362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium5114Open in IMG/M
3300026121|Ga0207683_11214959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales699Open in IMG/M
3300026300|Ga0209027_1122104All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300026327|Ga0209266_1119471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1122Open in IMG/M
3300027866|Ga0209813_10149035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium836Open in IMG/M
3300028878|Ga0307278_10546350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300031561|Ga0318528_10472590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300031682|Ga0318560_10193444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1085Open in IMG/M
3300031819|Ga0318568_10764797All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300031879|Ga0306919_11136257Not Available595Open in IMG/M
3300031896|Ga0318551_10152624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1261Open in IMG/M
3300032009|Ga0318563_10533751Not Available634Open in IMG/M
3300032065|Ga0318513_10197054Not Available970Open in IMG/M
3300032177|Ga0315276_10084344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_93195Open in IMG/M
3300032261|Ga0306920_100164612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3306Open in IMG/M
3300032401|Ga0315275_10153821All Organisms → cellular organisms → Bacteria2551Open in IMG/M
3300032782|Ga0335082_10229326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1746Open in IMG/M
3300032893|Ga0335069_10390670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1634Open in IMG/M
3300032954|Ga0335083_10429888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1121Open in IMG/M
3300032955|Ga0335076_11004700Not Available717Open in IMG/M
3300033412|Ga0310810_10556657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1118Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.22%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.48%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.61%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.74%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.87%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.87%
SoilEngineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2065487018Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010227Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2EngineeredOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPINP_025554602065487018SoilMHARKDPPRSRRVLRLIALERAVRGVLLLVGGIYLLFHLHSDFGRLATRAI
JGI10216J12902_10212767523300000956SoilMVGAMTGAADPQRSRRVLKLIALERGARGLLLLAAGVYLLFHL
Ga0063454_10203070013300004081SoilMRAGDPPRTRLVIRLIAIERSLRGILLLAAGTYLLFHLNTDFGHLAERIIR
Ga0062593_10130673223300004114SoilLTRAADRPRSRRILRLIAVERIARGVLLLTAGVYLLFNLNSDFGR
Ga0062589_10197012523300004156SoilMTGAADPPRSRRVLRLIAVERAARGLLLLGAGVYLLFHLNTDF
Ga0062594_10048140833300005093SoilVVNAAADPPRSRRFLRLIALERMVRGVLLLAAGVYLLFHLSSDFGRL
Ga0066388_10288280713300005332Tropical Forest SoilMAAGAVHSPRSRLVLRLIAVERVGRGLLLLFAGVYLLFHLNSDLGRLGERVMRAI
Ga0070677_1087375913300005333Miscanthus RhizosphereMTRAADRPRSRRVLRLIALERIARGVLLLSAGVYLLFNLNSDFGRLAERVMRAI
Ga0068869_10115955223300005334Miscanthus RhizosphereVTEATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFG
Ga0068868_10043058633300005338Miscanthus RhizosphereMAGATDPPRSRRVLRLIALERAGRGVLLLGAGVYLLFHLNSDFGRLGERVMRAIELDPRRPFFHRIVV
Ga0070689_10012346423300005340Switchgrass RhizosphereMTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFNLNSDFGRLAERVMRAIE
Ga0070671_10033011913300005355Switchgrass RhizosphereMTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFNLNSDFGRLAE
Ga0070703_1004250223300005406Corn, Switchgrass And Miscanthus RhizosphereMTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFNLNSD
Ga0070709_1103732713300005434Corn, Switchgrass And Miscanthus RhizosphereMTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDF
Ga0070714_10233015913300005435Agricultural SoilMGLDDPPRTRLVLRLIAVERSIRGLILLAAGVYLLFHLSTDLGRLSERIMRSI
Ga0070708_10021072813300005445Corn, Switchgrass And Miscanthus RhizosphereMTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRLGERVMRAIE
Ga0066681_1073486923300005451SoilMPVRAGDPPRTRLVLRLIAVERSVRGVILVAAGVYLLFHLSTDFGRLAERVARSID
Ga0070698_10030330213300005471Corn, Switchgrass And Miscanthus RhizosphereMTGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRL
Ga0070686_10040307033300005544Switchgrass RhizosphereMAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRLGERVMRAIELDPRR
Ga0066695_1066149523300005553SoilMRAGDPPRTRLVIRLIAVERSLRGVLLLAAGVYLLFHLN
Ga0066698_1076436513300005558SoilMTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRLGERVMRAIELDP
Ga0068855_10119852113300005563Corn RhizosphereVTEATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRL
Ga0066705_1015264713300005569SoilMTGAADPPRSRRVLRLIALERAGRGLLLLAAGGYLLFHLNSDFGRL
Ga0066706_1095985913300005598SoilMRAGDPPRTRLVLRLIAVERSLRGLLLLAAGTYLLFHLSTDFGQLAERIIR
Ga0068856_10256034233300005614Corn RhizosphereVTGAADPPRSRRFLRLIALERIARGVLLLAAGVYL
Ga0068866_1069827913300005718Miscanthus RhizosphereMAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRLGERVIRA
Ga0070717_1200452813300006028Corn, Switchgrass And Miscanthus RhizosphereVAGADDPSRSRRFLRVIALERIARGVLLLAAGVYLLFHLSSDFGRLADHAIRAIELD
Ga0066656_1037550733300006034SoilMTKAHDQRRSRRVLRLIAAERIIRGVLLLGAGVYLLF
Ga0075368_1020429323300006042Populus EndosphereMAKADDQPRSRRVLRLIAAERIVRGVLLLAAGVYLL
Ga0075432_1018972323300006058Populus RhizosphereMAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLN
Ga0074056_1179116213300006574SoilVDALVIVMGAMTRVADRPRSRRVLRLIALERIARGVLLLSAGVYLLFNLNSDFGRLA
Ga0074047_1157907513300006576SoilMTSAGIRPRNRRVLRLIALERIVRGALLLGAGVYLLFHLNSDFGRLGER
Ga0079222_1059282813300006755Agricultural SoilMAKAHDQPRGRRVVRLIAAERLVRGVLLLSAGVYLLFHVNNDFGRVAER
Ga0066653_1005178953300006791SoilMTQARDSSRSRRVLRLIALERIARSLFLLAAGTYLVSHLG
Ga0066653_1013586333300006791SoilMRAGDPPRTRLVIRLIAIERSLRGVLLLAAGTYLLFHLNTDFGHLAERIIRSIDVD
Ga0066665_1140473913300006796SoilMTGATDPPRSRRVLRLIALERAGRGLLLLAAVVYLLFHLNSDFGRLGERVMRAIELDPR
Ga0066659_1020210013300006797SoilMRAGDPPRTRLVLRVIAIERSLRGLLLLAAGTYLLFHLSTDFGQLA
Ga0075425_10140051023300006854Populus RhizosphereMRAGDPPRTRLVIRLIAIERSLRGVLLLAAGVYLLFHL
Ga0114129_1022624113300009147Populus RhizosphereMRAGDPPRTRLVLRLIALERSLRGLILLAAGTYLLFHLSTDLGQLAERVIR
Ga0114129_1096933013300009147Populus RhizosphereMTGAADPPRSRRVLRLIAVERAARGLLLLGAGVYLLFHLNTDFGRLGERVMRAI
Ga0075423_1178450723300009162Populus RhizosphereMAQADDQPRSRRVLRLIAAERIVRGVLLLAAGVYLLFHV
Ga0075423_1290958023300009162Populus RhizosphereVTGAADPPRSRRFLRLIALERMARGVLLLAAGVYLLF
Ga0105242_1007317413300009176Miscanthus RhizosphereMAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGR
Ga0105248_1128877613300009177Switchgrass RhizosphereMADAHDAPRSRRLIRLIAIERAIRGLLLAAGGIYLLAHLGADYGKL
Ga0126373_1159313523300010048Tropical Forest SoilVTRPADPPRSRRIIRLIALERAVRGVLLIGAGIYLFTHLGTDFGRLADHIMRAIEL
Ga0136219_101912923300010227SoilMRAGDPPRTRLVLRLIAVERSLRGLLLLAAGTYLLFHLSTDF
Ga0134064_1023941613300010325Grasslands SoilMRAGDPSRTRLVLRLIAIERSLRGVLLLAAGTFLLFHL
Ga0134071_1045131923300010336Grasslands SoilMRAGDPPRTRLVIRVIAIERSLRGVLLLAAGVYLLFHLS
Ga0134121_1112787023300010401Terrestrial SoilMAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRLGERVIRAI
Ga0134123_1164284323300010403Terrestrial SoilMTRAADRPRSRRVLRLIAVERIARGVLLLTAGVYLLF
Ga0151490_176581213300011107SoilMRAGDPSRTRLVLRLIAIERSVRGLLLIVAGTYLLFHLSTDFGRLAER
Ga0105246_1204200223300011119Miscanthus RhizosphereMTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFNLNSDFG
Ga0137392_1119819523300011269Vadose Zone SoilMRAGDPPRTRLVLRLIAIERSLRGVLLLAAGTYLLFHLSTDFGQLAERIIRRI
Ga0120118_107726533300012010PermafrostVGPVTEVRDPPRSRRILRLIALERLIRGVILIIAGAYLLTHLGSDLGRIADRLMRALE
Ga0137374_1082729813300012204Vadose Zone SoilVYALVIVVGAMTRAADRPRSRRILRLIALERIARGVLLLATGVYLLFHLNSDFGRLAERVMR
Ga0137376_1029505733300012208Vadose Zone SoilMRAGDPPRTRLVIRVIAIERSLRGVLLLAAGVYLLFHL
Ga0137376_1072560923300012208Vadose Zone SoilMTRAGDPPRSRRVLRLIALERSVRSLLLVAAGIYLLAHLGSDFGRI
Ga0137379_1118357323300012209Vadose Zone SoilMRAGDPPRTRLVLRLIAVERSLRGLLLLAAGTYLLFHLS
Ga0137378_1001813713300012210Vadose Zone SoilMTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRL
Ga0137377_1194479713300012211Vadose Zone SoilMRAGDPPRTRLVLRLIAIERSLRGMLLLAAGTYLLFHLSTDFGHLAERIIRS
Ga0137372_1108378613300012350Vadose Zone SoilLGACVVVAIVPAMATAGDAPRSRRILRLIALERSVRGVLLLAAGAYLITHLGSDFGRVADHAMRAVELDPRRPF
Ga0137367_1076660613300012353Vadose Zone SoilVGLVVAIVPAMATAGDAPRSRRILRLIALERSARGVLLLAAGAYLITHLGSDFGRVADHAMRAVELDPRR
Ga0137384_1105165813300012357Vadose Zone SoilMRAGDPSRTRLVLRVIAIERALRGLLLLAAGTYLLFHLS
Ga0164301_1176171733300012960SoilMTSASDRPRGRRVLRLIALERIVRGLLLLGAGVYLLFHLNSDF
Ga0164301_1184162513300012960SoilMGTDSAGDPPRSRRILRLIALERIVRGVLLFGAGVYLLFHLNSDF
Ga0164302_1094379823300012961SoilMTGAADPPRSRRFLRLIALERAGRGLLLLAAGGYLLFHLNSELGRLAERV
Ga0134076_1040596613300012976Grasslands SoilMTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRLGERVMR
Ga0164308_1084134823300012985SoilMTSASDPPRGRRVLRLIALERIVRGLLLLGAGVYLLFHLN
Ga0164304_1056406123300012986SoilLTRAADRPRSRRILRLIALERIGRGVLLLTAGVYLLFNLNSDFGRLAERVMRAIELDP
Ga0164305_1031319223300012989SoilMGADPPRTRVVLRVIAIERCLRGLLLLAAGVYLLFHLNTDFGRLAERIIR
Ga0157373_1121652223300013100Corn RhizosphereMAGATDPPRSRRVLRLIALERAGRGVLLLSAGVYLLFHLNSDFGRLGERVIRA
Ga0157371_1038708513300013102Corn RhizosphereMTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFN
Ga0157378_1259952533300013297Miscanthus RhizosphereVAGAGDPPRSRRVIRLIAAERFLRGLVLIAAGGYLLTHLGSDLG
Ga0134085_1055117323300015359Grasslands SoilMRAGDPPRTRLVLRLIAVERSLRGLLLLAAGTYLLFHLSTDFGQLAE
Ga0132256_10324546213300015372Arabidopsis RhizosphereVAGAGDPQRSRVVLKLIAGERFVRGILLLAAGTYLLTHQNK
Ga0182041_1084586413300016294SoilMSSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLL
Ga0182034_1132314433300016371SoilMTSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLLFHLNSDF
Ga0182038_1057816113300016445SoilMSSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLLFHLNS
Ga0187786_1047981323300017944Tropical PeatlandMTEASEPRRARRILWLIALERIIRGALLLAAGIYLLFHL
Ga0187785_1066904713300017947Tropical PeatlandMTEASEPRRTRRVLRLIALERIIRGALLLAAGIYLLFHLNSDFGRLA
Ga0187773_1003525513300018064Tropical PeatlandMTAGTASPRSRRVLRLIAAERIVRGVLLLAAGVYLL
Ga0187774_1009054013300018089Tropical PeatlandMPAARVRERRVTVPVAMSRADDQPRSRRVLRLIAIERMVRGALLLAAGVYLLFHLNKDFG
Ga0066667_1005662013300018433Grasslands SoilMTGATDPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFG
Ga0066667_1156579523300018433Grasslands SoilLGMTSAEDRPRSRRVLRLIGLERIVRGALLLGAGVYLLFHLNSAFARLGERVM
Ga0066662_1202558423300018468Grasslands SoilMRAGDPPRTRLVLRLIAVERSLRGALLVAAGLYLLFHLSTDLGHLAE
Ga0193750_101733713300021413SoilMRAGDPPRTRLVLRLIAIERSLRGVLLLAAGTYLLFNLSTDF
Ga0207642_1019357933300025899Miscanthus RhizosphereMAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFG
Ga0207684_1097743013300025910Corn, Switchgrass And Miscanthus RhizosphereMTGAADPPRSRRFLRLIALERAGRGVLLLAAGVYLLFHLNSDF
Ga0207654_1033290013300025911Corn RhizosphereMAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRLGERVIRAIELDPRR
Ga0207671_1145102213300025914Corn RhizosphereMTGAADPPRSRRFLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRLGERVMRAITAMATWNGNS
Ga0207693_1013281233300025915Corn, Switchgrass And Miscanthus RhizosphereMAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSD
Ga0207664_1050831913300025929Agricultural SoilMAGATDPPRSRRVLRLIALERAGRGVLLLAAGVYLLFHLNSDFGRLGERVIR
Ga0207667_1203201113300025949Corn RhizosphereVDALVIVVGPMTRAADRPRSRRVLRLIALERIARGVLLLTAGVYLLFNLNSDFGRLAERVMRA
Ga0207683_1002536213300026121Miscanthus RhizosphereMAGATDPPRSRRVLRLIALERAGRGVLLLSAGVYLLFHLNSDF
Ga0207683_1121495913300026121Miscanthus RhizosphereVAGAGDPPRSRRVIRLIAAERFLRGLVLIAAGGYLLTHLG
Ga0209027_112210413300026300Grasslands SoilMTGAADPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSD
Ga0209266_111947113300026327SoilMTHAGDTPRSRRILRLIALERTVRSLLLLAAGVYLLTHLK
Ga0209813_1014903523300027866Populus EndosphereMAKAVDQPRSRRVLRLIAAERIVRGVLLLAAGVYLL
Ga0307278_1054635013300028878SoilMTRAADPPRSRRVLRLIALERAGRGLLLLAAGVYLLFHLNSDFGRLGERVMRAIELDPRR
Ga0318528_1047259033300031561SoilMTSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLLFHLNSDFGR
Ga0318560_1019344413300031682SoilMSSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLLFHLNSDF
Ga0318568_1076479723300031819SoilMTSTEAQPRSRLVLRLIALERIVRGALLLGAGVYLLFHLNSDFGRLGERVMRAI
Ga0306919_1113625733300031879SoilVARTDPPRSRRIIRLIALERMVRGVALLAAGIYLVTHSHSDF
Ga0318551_1015262433300031896SoilMSSAGDRPRSRRLLRLIALERIVRGVLLLAAGIYLLF
Ga0306922_1056912133300032001SoilVAGAHDPPRSRRLLRLIALERIVRGLLLLAAGIYLLSHLGSDLGKTADRIMRAVELD
Ga0318563_1053375113300032009SoilMTGASDPPRSRRLLKVIAVERVVRSLLLLAAGVYLLK
Ga0318513_1019705413300032065SoilMTGASDPPRSRRLLKVIAVERVVRSLLLLAAGVYLLKHVTSDFGRISERIMRA
Ga0315276_1008434443300032177SedimentLTRAGDAPRSRRILRLIALERGIRGVVLLAAGAYLLFHLSTDFGRWAERAMRAVELD
Ga0306920_10016461213300032261SoilMTSTEAQPRSRLVLRLIALERIVRGALLLGAGVYLLFHLNSDFGRLGERVMR
Ga0315275_1015382113300032401SedimentLTRAGDAPRSRRILRLIALERGIRGVVLLAAGAYL
Ga0335082_1022932613300032782SoilMGTNSAGDPPRSRRILRLIALERIVRGVLLLGAGVY
Ga0335069_1039067033300032893SoilMGTNSAGDRPRSRRILRLIALERIVRGALLLGAGVYLLFHLNSDFGRLGERVMRAIELDP
Ga0335083_1042988813300032954SoilMSGADDRPHSRRVLRLIAVERIARGALLLAAGVYLLF
Ga0335076_1100470013300032955SoilMTGAADPPRSRRLLKVIAVERALRGLLLLAAGAYLLTHV
Ga0310810_1055665713300033412SoilMAKAHDQRRSRRVLRLIAAERIVRGTLLLAAGIYLLFNVNS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.