Metagenome Family F081940

Basic Information
Family ID	F081940
Family Type	Metagenome
Number of Sequences	114
Average Sequence Length	40 residues
Representative Sequence	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLN
Number of Associated Samples	19
Number of Associated Scaffolds	114

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.88 %
% of genes near scaffold ends (potentially truncated)	21.93 %
% of genes from short scaffolds (< 2000 bps)	41.23 %
Associated GOLD sequencing projects	19
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Most Common Taxonomy
Group	Unclassified (54.386 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (61.404 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (77.193 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF00078	RVT_1	1.75
PF03732	Retrotrans_gag	1.75
PF03405	FA_desaturase_2	0.88
PF09735	Nckap1	0.88
PF00875	DNA_photolyase	0.88
PF04618	HD-ZIP_N	0.88
PF14223	Retrotran_gag_2	0.88
PF13650	Asp_protease_2	0.88
PF05699	Dimer_Tnp_hAT	0.88
PF01657	Stress-antifung	0.88
PF02866	Ldh_1_C	0.88
PF00067	p450	0.88
PF13963	Transpos_assoc	0.88

COG ID	Name	Functional Category	% Frequency in 114 Family Scaffolds
COG0039	Malate/lactate dehydrogenase	Energy production and conversion [C]	0.88
COG0415	Deoxyribodipyrimidine photolyase	Replication, recombination and repair [L]	0.88
COG2124	Cytochrome P450	Defense mechanisms [V]	0.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
All Organisms	root	All Organisms	45.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
cellular organisms	root	All Organisms → cellular organisms	45.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	43.86 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	43.86 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	43.86 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	43.86 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	43.86 %
Sphingobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	36.84 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	36.84 %
Sphingobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	36.84 %
unclassified Sphingobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	36.84 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	34.21 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	34.21 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	34.21 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	30.70 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2035918001\|WWPM1086_GHCZ7500_g1	Not Available	700	Open in IMG/M
3300028786\|Ga0307517_10001210	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	43383	Open in IMG/M
3300028786\|Ga0307517_10008082	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	15161	Open in IMG/M
3300028786\|Ga0307517_10014568	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	10549	Open in IMG/M
3300028786\|Ga0307517_10023725	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7606	Open in IMG/M
3300028786\|Ga0307517_10043114	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4814	Open in IMG/M
3300028786\|Ga0307517_10054702	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3938	Open in IMG/M
3300028786\|Ga0307517_10058207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	3728	Open in IMG/M
3300028786\|Ga0307517_10144444	Not Available	1656	Open in IMG/M
3300028786\|Ga0307517_10350203	Not Available	802	Open in IMG/M
3300028786\|Ga0307517_10500523	Not Available	618	Open in IMG/M
3300028786\|Ga0307517_10516161	Not Available	604	Open in IMG/M
3300028786\|Ga0307517_10582012	Not Available	554	Open in IMG/M
3300028786\|Ga0307517_10622514	Not Available	528	Open in IMG/M
3300028794\|Ga0307515_10010769	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	17453	Open in IMG/M
3300028794\|Ga0307515_10018229	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	12732	Open in IMG/M
3300028794\|Ga0307515_10020117	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	11939	Open in IMG/M
3300028794\|Ga0307515_10036228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7989	Open in IMG/M
3300028794\|Ga0307515_10061190	Not Available	5348	Open in IMG/M
3300028794\|Ga0307515_10084399	Not Available	4079	Open in IMG/M
3300028794\|Ga0307515_10093609	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	3723	Open in IMG/M
3300028794\|Ga0307515_10103404	Not Available	3414	Open in IMG/M
3300028794\|Ga0307515_10107796	Not Available	3288	Open in IMG/M
3300028794\|Ga0307515_10175340	Not Available	2117	Open in IMG/M
3300028794\|Ga0307515_10343111	Not Available	1144	Open in IMG/M
3300028794\|Ga0307515_10486413	Not Available	846	Open in IMG/M
3300030521\|Ga0307511_10100188	Not Available	1907	Open in IMG/M
3300030522\|Ga0307512_10023075	Not Available	5566	Open in IMG/M
3300030522\|Ga0307512_10378712	Not Available	606	Open in IMG/M
3300031456\|Ga0307513_10022430	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	7423	Open in IMG/M
3300031456\|Ga0307513_10062163	Not Available	3948	Open in IMG/M
3300031456\|Ga0307513_10084436	Not Available	3261	Open in IMG/M
3300031456\|Ga0307513_10100367	Not Available	2920	Open in IMG/M
3300031456\|Ga0307513_10195142	Not Available	1871	Open in IMG/M
3300031456\|Ga0307513_10219776	Not Available	1722	Open in IMG/M
3300031456\|Ga0307513_10246014	Not Available	1589	Open in IMG/M
3300031456\|Ga0307513_10662541	Not Available	750	Open in IMG/M
3300031456\|Ga0307513_10672674	Not Available	741	Open in IMG/M
3300031456\|Ga0307513_10764680	Not Available	671	Open in IMG/M
3300031456\|Ga0307513_10795396	Not Available	651	Open in IMG/M
3300031507\|Ga0307509_10003323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	24604	Open in IMG/M
3300031507\|Ga0307509_10057256	Not Available	4133	Open in IMG/M
3300031507\|Ga0307509_10060657	Not Available	3996	Open in IMG/M
3300031507\|Ga0307509_10157195	Not Available	2177	Open in IMG/M
3300031507\|Ga0307509_10196617	Not Available	1859	Open in IMG/M
3300031507\|Ga0307509_10298375	Not Available	1361	Open in IMG/M
3300031507\|Ga0307509_10709037	Not Available	672	Open in IMG/M
3300031507\|Ga0307509_10916270	Not Available	541	Open in IMG/M
3300031616\|Ga0307508_10055320	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	3515	Open in IMG/M
3300031616\|Ga0307508_10203903	Not Available	1578	Open in IMG/M
3300031616\|Ga0307508_10279848	Not Available	1261	Open in IMG/M
3300031616\|Ga0307508_10336716	Not Available	1100	Open in IMG/M
3300031616\|Ga0307508_10375034	Not Available	1013	Open in IMG/M
3300031616\|Ga0307508_10416975	Not Available	934	Open in IMG/M
3300031616\|Ga0307508_10733998	Not Available	599	Open in IMG/M
3300031649\|Ga0307514_10392062	Not Available	714	Open in IMG/M
3300031649\|Ga0307514_10491178	Not Available	587	Open in IMG/M
3300031730\|Ga0307516_10005297	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	15521	Open in IMG/M
3300031730\|Ga0307516_10327598	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1201	Open in IMG/M
3300031730\|Ga0307516_10412600	Not Available	1008	Open in IMG/M
3300031730\|Ga0307516_10538929	Not Available	821	Open in IMG/M
3300031730\|Ga0307516_10691380	Not Available	676	Open in IMG/M
3300031730\|Ga0307516_10865299	Not Available	568	Open in IMG/M
3300031838\|Ga0307518_10091330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	2190	Open in IMG/M
3300031838\|Ga0307518_10215435	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1259	Open in IMG/M
3300031838\|Ga0307518_10464081	Not Available	670	Open in IMG/M
3300032354\|Ga0325403_1001113	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	21737	Open in IMG/M
3300032354\|Ga0325403_1003154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	14926	Open in IMG/M
3300032354\|Ga0325403_1003953	Not Available	13679	Open in IMG/M
3300032354\|Ga0325403_1004868	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	12563	Open in IMG/M
3300032354\|Ga0325403_1006616	Not Available	11046	Open in IMG/M
3300032354\|Ga0325403_1008628	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	9738	Open in IMG/M
3300032354\|Ga0325403_1009975	Not Available	9057	Open in IMG/M
3300032354\|Ga0325403_1011259	Not Available	8490	Open in IMG/M
3300032354\|Ga0325403_1015175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7199	Open in IMG/M
3300032354\|Ga0325403_1016827	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	6769	Open in IMG/M
3300032354\|Ga0325403_1018132	All Organisms → cellular organisms → Bacteria	6470	Open in IMG/M
3300032354\|Ga0325403_1019649	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	6149	Open in IMG/M
3300032354\|Ga0325403_1023929	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	5394	Open in IMG/M
3300032354\|Ga0325403_1027534	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4870	Open in IMG/M
3300032354\|Ga0325403_1031449	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	4416	Open in IMG/M
3300032354\|Ga0325403_1032703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	4282	Open in IMG/M
3300032354\|Ga0325403_1050973	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	2867	Open in IMG/M
3300032354\|Ga0325403_1053123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	2747	Open in IMG/M
3300032354\|Ga0325403_1076310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	1778	Open in IMG/M
3300032355\|Ga0325401_1002041	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	17629	Open in IMG/M
3300032355\|Ga0325401_1003090	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	15103	Open in IMG/M
3300032355\|Ga0325401_1014336	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7578	Open in IMG/M
3300032355\|Ga0325401_1034218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4348	Open in IMG/M
3300032355\|Ga0325401_1089421	Not Available	1793	Open in IMG/M
3300032355\|Ga0325401_1091189	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	1753	Open in IMG/M
3300032374\|Ga0325400_1009901	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	9116	Open in IMG/M
3300032374\|Ga0325400_1142320	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	1305	Open in IMG/M
3300032389\|Ga0325405_1001671	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	22641	Open in IMG/M
3300032389\|Ga0325405_1009711	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	9385	Open in IMG/M
3300032389\|Ga0325405_1011808	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	8370	Open in IMG/M
3300032389\|Ga0325405_1066754	Not Available	1702	Open in IMG/M
3300032390\|Ga0325404_1003954	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	15795	Open in IMG/M
3300032735\|Ga0325410_1000599	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	37935	Open in IMG/M
3300032735\|Ga0325410_1017669	Not Available	6896	Open in IMG/M
3300033180\|Ga0307510_10124373	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	2273	Open in IMG/M
3300033180\|Ga0307510_10129177	Not Available	2206	Open in IMG/M
3300033180\|Ga0307510_10455953	Not Available	719	Open in IMG/M
3300033180\|Ga0307510_10525487	Not Available	627	Open in IMG/M
3300033180\|Ga0307510_10598996	Not Available	553	Open in IMG/M
3300034389\|Ga0325419_000990	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	31221	Open in IMG/M
3300034389\|Ga0325419_002751	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	19827	Open in IMG/M
3300034389\|Ga0325419_010873	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	9381	Open in IMG/M
3300034389\|Ga0325419_022820	Not Available	5496	Open in IMG/M
3300034389\|Ga0325419_023160	Not Available	5434	Open in IMG/M
3300034389\|Ga0325419_042465	Not Available	2983	Open in IMG/M
3300034389\|Ga0325419_049286	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	2483	Open in IMG/M
3300034389\|Ga0325419_067118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	1577	Open in IMG/M
3300034389\|Ga0325419_095049	Not Available	893	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.12%
Engineered	Engineered	0.88%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.12%
Wastewater	Engineered → Wastewater	0.88%

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	61.40%
Wood	Host-Associated → Plants → Wood	29.82%
Phylloplane	Host-Associated → Plants → Phylloplane	7.89%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	0.88%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	61.40%
Unclassified	Host-Associated → Plants → Wood → Unclassified	29.82%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	7.89%
Dissolved Organics (Aerobic)	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic)	0.88%

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F081940

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2035918001	Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Visp-2009 (Newbler)	Engineered	Open in IMG/M
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated	Open in IMG/M
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
WWPMV_30620	2035918001	Wastewater Plasmid Pools	LIEIRGQIAKKLKFWGQLGFKLIKFAAKDQYAKGAKL
Ga0307517_100012102	3300028786	Ectomycorrhiza	LIKIRGQIARKLKFWGQLGAGLKKFGAKDQSAKGATIEGLN
Ga0307517_100080827	3300028786	Ectomycorrhiza	LIEIRGKIARKLKFLGQLGVKLTKFTVNDQSAKGARGLN
Ga0307517_100145683	3300028786	Ectomycorrhiza	LIGIKGQIARKLKFWGQLGAKLKKFTDKDQSAKGAKIEELN
Ga0307517_100237254	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFSGPLGVELTKFAAKDVSVKGAKL
Ga0307517_100431142	3300028786	Ectomycorrhiza	LFEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIKGLN
Ga0307517_100547027	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLD
Ga0307517_100582071	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKLTAKDVSVKDAKIKGLN
Ga0307517_101444441	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAKLKKFAAKDQSAKGAKIEGLK
Ga0307517_103502031	3300028786	Ectomycorrhiza	LIEIKGQLARKLKFWGQLGAGLKKFVVKDQYAKGATIEELN
Ga0307517_105005231	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAKLKKFAANDQSAKGAKIEGLK
Ga0307517_105161611	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKLTAKDVSEKGAKIKGLN
Ga0307517_105820121	3300028786	Ectomycorrhiza	LVEIRGQIAIKLKFWGQLEAKLKKLAARGQSAKGAKMKGLN
Ga0307517_106225141	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAGLKKFATKDQSAKGATIEGLN
Ga0307515_100107693	3300028794	Ectomycorrhiza	LIEIRGPIARTLKFWGQLGVKLKKLTAKDHSAKGENIWGLN
Ga0307515_100182291	3300028794	Ectomycorrhiza	LIEIRGQTARKLKFWGQLGVKLKKLIAKDISVKGAKIKGLN
Ga0307515_1002011710	3300028794	Ectomycorrhiza	LIEIRGPIARKLKFWDQLGAGLKKFAPKDHSTKGATIEGLN
Ga0307515_100362282	3300028794	Ectomycorrhiza	LIEIRDKIARKLKFLGQLGVKLTKFAANDQSAKGARGLN
Ga0307515_100611902	3300028794	Ectomycorrhiza	LIEIRGKIARKLKFWGQLRAKLKKFAARDQSAKGAKI
Ga0307515_100843991	3300028794	Ectomycorrhiza	IEIRGQIARKLKFWGQLGVKLKKLTAKDVSVKGAKIKGLN
Ga0307515_100936094	3300028794	Ectomycorrhiza	LINIRGQIARKLKFWGQLGAGLKKFGAKDQSAKGATIEGLN
Ga0307515_101034041	3300028794	Ectomycorrhiza	FLPSQLIEIKDKIARKLKFWGQLGDKLKIFVAKDQSAKDVELQGLN
Ga0307515_101077962	3300028794	Ectomycorrhiza	LIEIRGQIARKLKFWGQLEAKLKKSEAKDQSAKGGKLWGFN
Ga0307515_101753402	3300028794	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKMTAKDDSVKGAKIKGLN
Ga0307515_103431112	3300028794	Ectomycorrhiza	LNGNKIFYQVLIEIRDQIARKLKFWGQLGAGLKKFAAKDQSAKGTTIEGFN
Ga0307515_104864131	3300028794	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLTDFAAKDQSAKGAKIGGLN
Ga0307511_101001881	3300030521	Ectomycorrhiza	LIEIRGKIARKLKFWGQLGAKLKKFAAKDQSAKGAKIEGLK
Ga0307512_100230755	3300030522	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKLTAKDVSVKGAKIKG
Ga0307512_103787121	3300030522	Ectomycorrhiza	LIGIKGQIARKLKFWGQLGAKVKKFTDKDQSAKGAKIEELN
Ga0307513_1002243011	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLEAKLKKFAAKDQSAMAPKLRGLIDKKRG
Ga0307513_100621631	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKFTAKDQSAKGAGL
Ga0307513_100844362	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAGLKKFAANDQSAKGATIEGLN
Ga0307513_101003671	3300031456	Ectomycorrhiza	LIEIRGQIARKLEFMGQLGVKLKKFADKDHFVKGGRLWDLIG
Ga0307513_101951421	3300031456	Ectomycorrhiza	QIARKLKFWGQLGVKLTKSKAKDQTARGAKLQGPN
Ga0307513_102197761	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKMTAKDVSVKGAKIKGLN
Ga0307513_102460141	3300031456	Ectomycorrhiza	IEIRGQIARKLKFWGQLGVKLKKLTAEDVSVKGTKL
Ga0307513_106625411	3300031456	Ectomycorrhiza	GIRGKIARKFKFWGQLGVKSTKFASRDQSARGATL
Ga0307513_106726741	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKFAARDQFAKGAGL
Ga0307513_107646801	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAKLKKFAANDQYAKGAKIEGLN
Ga0307513_107953962	3300031456	Ectomycorrhiza	LPSYLIEIRGQIARKLKFWGQLGVKLKKFAARDQFAKGAGL
Ga0307509_100033235	3300031507	Ectomycorrhiza	LIEIRGQIARKLKFWGQLAAKLKKFAANNQSAKGAKIEELN
Ga0307509_100572561	3300031507	Ectomycorrhiza	LIEIRGQIGRKLKFWGQLGAKLKKFAAKDQSAKGAALWGLN
Ga0307509_100606573	3300031507	Ectomycorrhiza	EIRGQITRKLKFWGQLGVKLTKFTAKDQSVKWAKIEGLN
Ga0307509_101571954	3300031507	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKMIAKDVSVKDAKIKGLN
Ga0307509_101966171	3300031507	Ectomycorrhiza	LIEIKGQIARKLKFWGQLEAKLKKFAARDQSAKGAKIKGLN
Ga0307509_102983752	3300031507	Ectomycorrhiza	LIEIRGPIARKLKFWGQLGAGLKKFAPKNHSTKGATIEGLN
Ga0307509_107090372	3300031507	Ectomycorrhiza	RGKITRKLKFWSQLGAKLKKFATKDQSARGATIKGLN
Ga0307509_109162701	3300031507	Ectomycorrhiza	IEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLD
Ga0307508_100553202	3300031616	Ectomycorrhiza	LIEIRGQIARKLKFLGQLGVKLTKFTDNDHSATGAKL
Ga0307508_102039031	3300031616	Ectomycorrhiza	LIEIRGQIARKLKFLGQLGAKLKKFAAKDQSAKGAKIEGLK
Ga0307508_102798481	3300031616	Ectomycorrhiza	LIEIRDQIARKLKFWGQLGAGLKKFAAKDQSAKGTTIEGFN
Ga0307508_103367161	3300031616	Ectomycorrhiza	EIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLD
Ga0307508_103750341	3300031616	Ectomycorrhiza	EIRGQIARKLKFWGQLGVKLTKSKAKGQSAKGAKL
Ga0307508_104169751	3300031616	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAKLKKLAARGQSAKGAKLRGLIEKHRG
Ga0307508_107339982	3300031616	Ectomycorrhiza	LIKIRGQIARTLKFWGQLGAGLKKFGAKDQSAKGATIEGLN
Ga0307514_103920621	3300031649	Ectomycorrhiza	LIEIRGQIARKLKFLGQLGVKLKKLTAKDVSVKGAKIKGLNXQNPGVK
Ga0307514_104911781	3300031649	Ectomycorrhiza	LIEIRGQIARKLKFWGQLAAKLKKFAANNQSAKGAKIKELN
Ga0307516_1000529714	3300031730	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKLTAKDVSVKGPNFRGLIDKNWG
Ga0307516_103275983	3300031730	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLEKLTAKDVSVKGAKIKGLN
Ga0307516_104126001	3300031730	Ectomycorrhiza	LIEIKGQIARKLKFWGQLGAKLKKSEAKDQSAKGGKLW
Ga0307516_105389291	3300031730	Ectomycorrhiza	IEIRRQIARKLKFWGQLGVKLKKLIAMDQSAKGVRL
Ga0307516_106913802	3300031730	Ectomycorrhiza	LIEIRDKIARKLKFLGQLGVKLTKFAANDQSAKGAR
Ga0307516_108652992	3300031730	Ectomycorrhiza	LIEIRGKIAIKLKFRGQLGAKLKKFAAKDQSAKGAKI
Ga0307518_100913301	3300031838	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKLTAKDQSAKGA
Ga0307518_102154353	3300031838	Ectomycorrhiza	PSYLIEIRGQIARKLKFWGQLGVKLKKFAARDQFAKGAGL
Ga0307518_104640811	3300031838	Ectomycorrhiza	IRGKITRKLKFWGQLRVILKKFTVNDQSVKSVKQWGLN
Ga0325403_10011137	3300032354	Xylem	LIKIKDKIARKSKFWSQLGVKLKKFAAKDQSAKGAELWGPN
Ga0325403_10031545	3300032354	Xylem	LIEIRSQIARKLKFWGQLGAGLKKFAAKDQSAKDATIEGLN
Ga0325403_10039537	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFVAKDQSAKGATIEGLN
Ga0325403_10048687	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLN
Ga0325403_10066162	3300032354	Xylem	LIEIRGQIARKLKFLDQLGVKLIKFAAKDQTAKGATIGGLN
Ga0325403_10086282	3300032354	Xylem	LIEIGGQIARILKFWGQFGARLKKFAAKDQSAKGATIEGLN
Ga0325403_10099752	3300032354	Xylem	LIEIRGQIARKLKFWGQLGTGLKKFAAKDQSAKGATIEGLN
Ga0325403_10112591	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGTTIEGLN
Ga0325403_10151754	3300032354	Xylem	LIEIRGQIARKLNFWGQLGVKLKKFAARDQFAKGVGL
Ga0325403_10168273	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGAIIEGLN
Ga0325403_10181322	3300032354	Xylem	LIEIRGQIARKLKFWGQLGTGLKKFAAKDQSAKGTTIEGLN
Ga0325403_10196494	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAKLKKFTAKDQSAKAPKLRGLIDKNRG
Ga0325403_10239291	3300032354	Xylem	LIEIKGQIARKLKFWGQLGAGLKKFATKDQSAKSATIEGLN
Ga0325403_10275342	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFVAKDQSAKGTTIEGLN
Ga0325403_10314491	3300032354	Xylem	LIEIKGQIARKLKFLGQLGAGLKKFAAKDQSAKSATIEGLN
Ga0325403_10327035	3300032354	Xylem	LIEIRGQIARKLKFWGQLRAGLKKFAAKDQSAKNATIEGLN
Ga0325403_10509732	3300032354	Xylem	IWGQIARKLNFWGQLGAKLNKSEAKDHSAIGGKLWGFN
Ga0325403_10531232	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIKGLN
Ga0325403_10763103	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAKLKKFAANDQSAKGATIKGLN
Ga0325401_10020419	3300032355	Xylem	LIEIRGQIARKLKFWGQLGVGLKKFVAKDQSAKGTTIEGLN
Ga0325401_100309021	3300032355	Xylem	LIKIKDKIARKSKFWSQLGVKLKKFAAKDQSAKGVELWGPN
Ga0325401_10143363	3300032355	Xylem	LIEIRGPIARKLKFWGQLGARLKKFAAKDQSAKDTTIEGLN
Ga0325401_10342182	3300032355	Xylem	LIEIRGHIARQLKFWGQLGARLKKFAAKDQSAKGTTIEGLN
Ga0325401_10894211	3300032355	Xylem	IEIRGKITRKSKLWYQLRVKLKKFTINNQSAKCTRL
Ga0325401_10911895	3300032355	Xylem	LIEIRGQIARKLKFWGQLGVGLKKFAAKDQSAKGTIIEGLN
Ga0325400_10099017	3300032374	Xylem	LIEIRGPITRKLKFWGQLGVKLKKLTAKDQSAKGAKI
Ga0325400_11423201	3300032374	Xylem	QIARKLNFWGQLGAKLNKSEAKDHSAIGGKLWGFN
Ga0325405_10016718	3300032389	Xylem	LIEIKGKIARKLKFWGQLGAKFKKFAANDQSAKSAKQ
Ga0325405_10097114	3300032389	Xylem	LIEIRGQIARKLKFWGQLRAALKKFAAKDQSAKDATIEGLN
Ga0325405_10118081	3300032389	Xylem	LIEIRGQIARKLKFWGQLGVKMTKFTAKDQSAKDAKIRGLN
Ga0325405_10667541	3300032389	Xylem	LIEIRCQIARKLKFLGQLGVKLVKFIAKDHSATGGKPWGLN
Ga0325404_10039543	3300032390	Xylem	LIEIRGQIARKLKFWGQLGVKLTKFAAKDQSAKGAKIGGFN
Ga0325410_10005993	3300032735	Xylem	LIEIKGQIARKLKFWGQLGAGLKKFATKDQSPKGTTIEGFN
Ga0325410_10176691	3300032735	Xylem	LIEIRGQIARKLKFLGQLGVKLIKFATKDQSAKGPKIGGLT
Ga0307510_101243731	3300033180	Ectomycorrhiza	EIRGQIAKTLKFWGQLGVKLKKLTAKDVSVKDAKL
Ga0307510_101291771	3300033180	Ectomycorrhiza	LIEIRGQITRKLKFWGQLEAKLKKFAAKDQSAKGAKIEGLK
Ga0307510_104559531	3300033180	Ectomycorrhiza	LIEIRGQIVRKLKFWGQLGVKLKKMTAKDVSVKGAKIKGLN
Ga0307510_105254871	3300033180	Ectomycorrhiza	EIRGQIARKLKFWGQLGVKLTKFAAKDQYAKSAKL
Ga0307510_105989962	3300033180	Ectomycorrhiza	LFEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLD
Ga0325419_000990_25388_25513	3300034389	Leaf	LIEIRGQIARKLKFWGQLGVKLTKFTAKDQSAKGAKIRGLN
Ga0325419_002751_3020_3145	3300034389	Leaf	LIEIGVQIARKLKFWGQLRAGLKKFAAKDQSAKCATIEGLN
Ga0325419_010873_4554_4679	3300034389	Leaf	LIEIRGQIARKLKFLGQLGVKLTKFAANDQYAKGAKIGGLN
Ga0325419_022820_4319_4444	3300034389	Leaf	LIEIRGQIARKLKFWGQLGVGLKKFTAKDQFAKGTTIEGLN
Ga0325419_023160_4257_4382	3300034389	Leaf	LIEIRGQIARKLKFWGQLGAGLKKFTAKDQFAKGTTIEGLN
Ga0325419_042465_84_197	3300034389	Leaf	LIEISGQIARKLKFLGQLGAKLKKFTAKDQSAKGIKL
Ga0325419_049286_68_193	3300034389	Leaf	LIEIRGQIARKLKFWGQLGARLKKFIAKDQSAKGTTIEGLN
Ga0325419_067118_544_657	3300034389	Leaf	LIEISGQIARKLKFFGQLGAKLKKFTAKDQSAKGTKL
Ga0325419_095049_41_154	3300034389	Leaf	LIEIGGQIARKLKFWGQLGVKLKKLIAKDQSAKGAKI

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign