NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F083237

Metagenome / Metatranscriptome Family F083237

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F083237
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 80 residues
Representative Sequence MVEMFKRSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPL
Number of Associated Samples 96
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 48.21 %
% of genes near scaffold ends (potentially truncated) 32.74 %
% of genes from short scaffolds (< 2000 bps) 97.35 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.230 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(20.354 % of family members)
Environment Ontology (ENVO) Unclassified
(57.522 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(67.257 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.16%    β-sheet: 0.00%    Coil/Unstructured: 54.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 113 Family Scaffolds
PF04832SOUL 0.88



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002027|MIS_10144876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1713Open in IMG/M
3300004463|Ga0063356_102093909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae858Open in IMG/M
3300005043|Ga0071100_1141711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300005069|Ga0071350_1017484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1766Open in IMG/M
3300005516|Ga0066831_10210120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea529Open in IMG/M
3300005662|Ga0078894_10840793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae800Open in IMG/M
3300005989|Ga0075154_10092284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1811Open in IMG/M
3300006165|Ga0075443_10425602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300006641|Ga0075471_10074526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1851Open in IMG/M
3300006803|Ga0075467_10079583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1983Open in IMG/M
3300006803|Ga0075467_10080455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1970Open in IMG/M
3300006803|Ga0075467_10111443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1616Open in IMG/M
3300006917|Ga0075472_10386456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea692Open in IMG/M
3300007094|Ga0102532_1177264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1813Open in IMG/M
3300007171|Ga0102977_1081521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1356Open in IMG/M
3300007231|Ga0075469_10160505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300007513|Ga0105019_1071494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1981Open in IMG/M
3300007863|Ga0105744_1141649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300007992|Ga0105748_10122713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1052Open in IMG/M
3300008832|Ga0103951_10549091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
3300008928|Ga0103711_10040816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea659Open in IMG/M
3300009003|Ga0102813_1280117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300009068|Ga0114973_10135383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1379Open in IMG/M
3300009071|Ga0115566_10109390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1767Open in IMG/M
3300009071|Ga0115566_10137714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1534Open in IMG/M
3300009071|Ga0115566_10304651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani939Open in IMG/M
3300009071|Ga0115566_10789211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300009080|Ga0102815_10810425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae533Open in IMG/M
3300009086|Ga0102812_10146151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1294Open in IMG/M
3300009151|Ga0114962_10113026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1674Open in IMG/M
3300009152|Ga0114980_10740320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300009163|Ga0114970_10147845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1415Open in IMG/M
3300009172|Ga0114995_10262405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani953Open in IMG/M
3300009432|Ga0115005_10248700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1391Open in IMG/M
3300009432|Ga0115005_10695144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300009432|Ga0115005_11471388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300009436|Ga0115008_10261244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1231Open in IMG/M
3300009441|Ga0115007_10138497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1560Open in IMG/M
3300009441|Ga0115007_10422821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani873Open in IMG/M
3300009442|Ga0115563_1135633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1004Open in IMG/M
3300009526|Ga0115004_10521867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300009677|Ga0115104_10668883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300009677|Ga0115104_10847518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300009785|Ga0115001_10946758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300010389|Ga0136549_10145412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1070Open in IMG/M
3300012036|Ga0136600_1021230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1651Open in IMG/M
3300012413|Ga0138258_1038497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1599Open in IMG/M
3300012413|Ga0138258_1730319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1597Open in IMG/M
3300012414|Ga0138264_1297090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea715Open in IMG/M
3300012504|Ga0129347_1174370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1681Open in IMG/M
3300012782|Ga0138268_1036106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani833Open in IMG/M
3300012782|Ga0138268_1038432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300012782|Ga0138268_1615660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300012954|Ga0163111_12124782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300017166|Ga0186523_103244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1797Open in IMG/M
3300017210|Ga0186339_104426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1790Open in IMG/M
3300017952|Ga0181583_10543286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea706Open in IMG/M
3300017967|Ga0181590_11009070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea542Open in IMG/M
3300018426|Ga0181566_10510643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani843Open in IMG/M
3300018698|Ga0193236_1060243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300018739|Ga0192974_1000676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea3111Open in IMG/M
3300018770|Ga0193530_1094897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300018871|Ga0192978_1028430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1041Open in IMG/M
3300018871|Ga0192978_1033144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae967Open in IMG/M
3300018928|Ga0193260_10093194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300018961|Ga0193531_10019523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2149Open in IMG/M
3300018982|Ga0192947_10052678All Organisms → Viruses → Predicted Viral1274Open in IMG/M
3300018996|Ga0192916_10179790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea624Open in IMG/M
3300019031|Ga0193516_10289710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300019036|Ga0192945_10024172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1504Open in IMG/M
3300019037|Ga0192886_10273260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea557Open in IMG/M
3300019045|Ga0193336_10193359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea809Open in IMG/M
3300019048|Ga0192981_10125640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1013Open in IMG/M
3300019048|Ga0192981_10146870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani932Open in IMG/M
3300019048|Ga0192981_10347692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea540Open in IMG/M
3300019051|Ga0192826_10360403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300019151|Ga0192888_10253107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea507Open in IMG/M
3300020048|Ga0207193_1356480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani997Open in IMG/M
3300020159|Ga0211734_10063060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1072Open in IMG/M
3300021169|Ga0206687_1964993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea640Open in IMG/M
3300021353|Ga0206693_1475260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea836Open in IMG/M
3300023439|Ga0256752_1065762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae833Open in IMG/M
3300023500|Ga0257021_1023783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1473Open in IMG/M
3300025848|Ga0208005_1024613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1851Open in IMG/M
3300025869|Ga0209308_10400414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani547Open in IMG/M
3300025887|Ga0208544_10086594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1436Open in IMG/M
3300025887|Ga0208544_10239328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani731Open in IMG/M
3300025887|Ga0208544_10250756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea708Open in IMG/M
3300025890|Ga0209631_10144417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1293Open in IMG/M
3300027720|Ga0209617_10285332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea620Open in IMG/M
3300027749|Ga0209084_1088840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1384Open in IMG/M
3300027784|Ga0207421_10299049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae666Open in IMG/M
3300027786|Ga0209812_10137446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1154Open in IMG/M
3300027810|Ga0209302_10201033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani954Open in IMG/M
3300027833|Ga0209092_10108259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1640Open in IMG/M
3300027849|Ga0209712_10584089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300027885|Ga0209450_10111966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1830Open in IMG/M
3300027899|Ga0209668_10388822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea911Open in IMG/M
3300027973|Ga0209298_10393992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani521Open in IMG/M
3300031005|Ga0073974_1702322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae665Open in IMG/M
3300031113|Ga0138347_11099238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1419Open in IMG/M
3300031602|Ga0307993_1194124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea508Open in IMG/M
3300031626|Ga0302121_10040512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1480Open in IMG/M
3300031717|Ga0307396_10335118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae723Open in IMG/M
3300032050|Ga0315906_11090450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300032275|Ga0315270_10082146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1858Open in IMG/M
3300032463|Ga0314684_10236188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1037Open in IMG/M
3300032747|Ga0314712_10375039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300032749|Ga0314691_10058693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1380Open in IMG/M
3300032756|Ga0315742_12874098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae554Open in IMG/M
3300032820|Ga0310342_102797472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea583Open in IMG/M
3300033984|Ga0334989_0153729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1276Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine20.35%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.04%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.73%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.31%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.31%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine5.31%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.54%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.65%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.65%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.77%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.77%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.77%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.77%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.77%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.89%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.89%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.89%
Sinkhole FreshwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.89%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.89%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.89%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.89%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.89%
Hydrothermal Fe-Rich MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat0.89%
MarineEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine0.89%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.89%
Alkaline SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment0.89%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.89%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.89%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002027Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5kEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007094Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A)EnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008928Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E3EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017166Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436)Host-AssociatedOpen in IMG/M
3300017210Metatranscriptome of marine eukaryotic communities from northern Puget Sound, Washington in Ciliate medium, 15 C, 30 psu salinity and 103 ?mol photons light - Favella ehrenbergii Fehren 1 (MMETSP0123)Host-AssociatedOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018698Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001473 (ERX1809465-ERR1739846)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023439Hydrothermal Fe-rich mat microbial community from TAG Site, Mid-Atlantic Ridge, Atlantic Ocean - 665-MMA12EnvironmentalOpen in IMG/M
3300023500Marine microbial mat from Loihi Seamount, Hawaii, USA - Marker 39_BS4 Individual AssemblyEnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027784Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED (SPAdes)EnvironmentalOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MIS_1014487623300002027Sinkhole FreshwaterMQQHVEKMVEMFKRSKFFLSVAQKMSYDEGFTFNESNIVSYLAELEEYISSLITYTAFKRDDPNAAISAIPLEKLN*
Ga0063356_10209390923300004463Arabidopsis Thaliana RhizosphereVTIFKRSRFFLSVAQRMSYEEGFTFNESNIVQYLAELEEYINSLLTYAAFKRDDPNAAISAIPL
Ga0071100_114171123300005043Marine Subseafloor AquiferMNDAENTKKMFKKVQSSVSQMVDLFKRSKFFLCVAQKMNYEDGIVFTENNIVPYLAELEEYISSLITYTAFKRDEPNAAICSI
Ga0071350_101748443300005069FreshwaterMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYISSLVTYMAFKKDDPNAVTSAIPLAQLNEKKFG*
Ga0066831_1021012013300005516MarineMFQEIQHSVGDMVEKFKQSKFFLCVAQKQNYKDGIVFTENNIVQYLAELEEYISSLITYTAFKKDDKNAAISSIPLEKLNEWKFDDKKM*
Ga0078894_1084079323300005662Freshwater LakeMMVEMFKRSKFYLSVATKMNYDEGFIFSESNIVSFLAELEEYICSLITYTAFKRDDP*
Ga0075154_1009228443300005989Wastewater EffluentMVEFFKRSRFFLSVAQKMSYDEGFTFNESNIVQYLAELEEYISSLITYTAFKKDDPNAAISAIPLEKLN*
Ga0075443_1042560213300006165MarineMFGKIQSSVATMVSMFKQSKFFLCVAQKMNYEDGIGFTENNIVSYLAELEEYISSLITYNAFKREDPNAAISCIPLDQLQEKQFVKKKD*
Ga0075471_1007452623300006641AqueousMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVSYLSELEEYIGSLIQYMAFKRDDPNAATSVIPFAQLNEKKFG*
Ga0075467_1007958333300006803AqueousVMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYVGSLITYMAFKRDDPNAATSAIPLA*
Ga0075467_1008045523300006803AqueousMFAKIQEPVQVMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYIGSLITYMAFKRDDPNAATSAIPLA*
Ga0075467_1011144323300006803AqueousMAQIKKMFARIQEPVEVMVDAFVATKFFLSVATKMNYDDKIVFTENNIVSYLAELEEYIGSLVTYMAFKKDDPNAATSAIPLAQLTYKNFG*
Ga0075472_1038645623300006917AqueousVMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYISSLVTYMAFKKDDPNAVTSAIPLAQLNEKKFG*
Ga0102532_117726423300007094Freshwater LakeMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYIGSLITYMAFKKDDPNAATSVIPLAQLNEKKFGQRDLDVSSPIFSN*
Ga0102977_108152113300007171Freshwater LakeMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYIGSLITYMAFKKDDPNAA
Ga0075469_1016050523300007231AqueousMFKKVQSSVALMVDMFKRSKFFLCVAQKMNYQDGIVFTENNIVSYLAELEEYISSLITYTAFKRDEPNAAISSIPLDKLEVKEFQKLKT
Ga0105019_107149433300007513MarineMVDMFKSSKFFLCVAQKQNYEDGIIFTENNIVSYLAELEEYISSLITYSAFKRDEPNAAIASIPLDRLTAKEF*
Ga0105744_114164933300007863Estuary WaterMVDMFKKSKFFLCVAQKQNYQDGIVFTENNIVQYLAELEEYISSLITYTAFKKEDPNAPI
Ga0105748_1012271333300007992Estuary WaterMFRKVQQHVEMMVEMFKRSKFYLSVATKMNYDEGFVFSESNIVSFLAELEEYICSLITYTAFKRDDPQAAISAIPLE
Ga0103951_1054909113300008832MarineMFRKIQSHVGVMVDMFKKSKFFLCVAQKQNYQDGIVFTENNIVQYLAELEEYISSLITYTAFKKEDPNAPICSIPLEKLNQKNFQ*
Ga0103711_1004081613300008928Ocean WaterMFKKIQESVEYMVEMFKRSKFHLAVATKMDYDEGFVFTENNIVQYLAELEEYINTLIVYTAFKK
Ga0102813_128011723300009003EstuarineVHMFKQSKFFLVVAARMNYESGIYFTENNIVSYLAELEEYISYLITYTAFKKDDPNAPISSIPLDNLNTKDHQEKVMSIEPPTDY*
Ga0114973_1013538333300009068Freshwater LakeMMVEMFKRSRFYLSVATKMSYDEGFIFSENNIVSYLAELEEYICSLITYSAFKRDDPQAAISAIPIEKLNTKIHERRD
Ga0115566_1010939023300009071Pelagic MarineMFKRSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKREDANAPISSIPLEKLNTKEFSKKTMFVSITSYYLN*
Ga0115566_1013771443300009071Pelagic MarineMFFKIQDHVETMVKMFKQSKFFLCVAQRMNYEDGITFTENNIVQYLAELEEYISSLITYNAFKRDEPNAAISSIPLEKLNQKDF*
Ga0115566_1030465133300009071Pelagic MarineMVDMFKKSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKREDANAPISSIPLEKLNTKEFSKKTMFVSIKFIKSLNLFDLN*
Ga0115566_1078921113300009071Pelagic MarineMNYEDGIGFTENNIVSYLAELEEYISSLITYNAFKREDPNAAISSIPLDQLQEKQFVKKKDQFDAPIDYTINNQDGQQTP*
Ga0102815_1081042513300009080EstuarineMFRKVQQHVEMMVEMFKRSKFYLSVATKMNYDEGFVFSESNIVSFLAELEEYICSLITYTAFKRDDP
Ga0102812_1014615113300009086EstuarineMFKKVQASVAMMVEMFKKSKFFLCVAQRMNYEDGIQFTENNIVSYLAELEEYISSLITYTAFKR
Ga0114962_1011302633300009151Freshwater LakeMFKKVQSSVSAMVEMFKRSKFFLCVAQMQSYSDGIAFTENNIVQYLAELEEYISSLITYTAFKREDPNAAISSIPLEKLNKKEF*
Ga0114980_1074032013300009152Freshwater LakeSTKKMFKKVQSSVSAMVEMFKRSKFFLCVAQMQSYSDGIAFTENNIVQYLAELEEYISSLITYTAFKREDPNAAISSIPLEKLNKKEF*
Ga0114970_1014784513300009163Freshwater LakeMVEMFKRSKFYLSVAQKMNYDEGFIFSESNIVSFLAELEEYICSLITYTAFKRDDPQAAISAIPLEKLFTKDFNRKDI*
Ga0114995_1026240513300009172MarineMVEMFKQSKFFLCVAQKQNYQNGIIFTENNIVSYLAELEEYMSSLITYTAFKKEDPNAPICSIPLEQLNNKNFKQAKIHIEPPTDWEPKQAADGTASEID
Ga0115005_1024870043300009432MarineMVEMFKRSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPL
Ga0115005_1069514413300009432MarineMVEMFKKSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPLENLNAKDHNKKIMTIEPPTDY*
Ga0115005_1147138813300009432MarineSFEKIQKSVRTMVEMFKRSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPLENLNAKDHNKKIMTIEPPTDYQINT*
Ga0115008_1026124423300009436MarineMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVSYLAELEEYISSLVTYMAFKRDDPNAATSAIPLQ*
Ga0115007_1013849733300009441MarineMVEAFVSTKFFLSVAHKMNYDDGIVFTENNIVSYLAEVEEYISSLVTYMAFKRDDPNAATSAIPLEQLNDKKFGQRDLDVSL*
Ga0115007_1042282113300009441MarineMFKKIQSHVNVMVDMFKRSKFFLCVAQKQNYEDGITFTENNIVSYLAELEEYISSLITYSAFKRDEPNAAIASIPLDRLTAKDFQ*
Ga0115563_113563333300009442Pelagic MarineMFKRSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKREDANAPISSIPLEKLNTKEFSKKTMFIDAPIDYQIVNKNEGQDVG*
Ga0115004_1052186713300009526MarineMVDMFKKSKFFLCVAQKQNYQDGIVFTENNIVQYLAELEEYISSLITYTAFKKEDPNAPICSIPLEKLNQKNFQQAKINIDPPTDWQQNQEGADVE*
Ga0115104_1066888323300009677MarineMVKMFKDSKFFLCVAQKMNYEDGIIFTENNIVSYLAELEEYISSLITYNAFKREDPNAAISSIPLDQLLAKEFNKKKDQFDAPID
Ga0115104_1084751823300009677MarineMVDMFKKSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLVTYTAFKREDANAPISSIPLEKLNTKEFSKKTMFLELPID*
Ga0115001_1094675813300009785MarineMFTKIQKSVNSMVDMFKRSKFFLCVAQKQNYEDGIIFTENNIVSYLAELEEYISSLITYSAFKRDEPNAAIASIPLDRLTAKDFQ*
Ga0136549_1014541233300010389Marine Methane Seep SedimentMFRKLQQHVEMMVEMFKRSKFFLSVAQKMTYDEGFTFTENNIVQYLAELEEYICSLIIYTAFKRDDPNAAISAIPLESLP
Ga0136600_102123023300012036Saline LakeVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKRDEPNAAIASIPLDKLEVKEFHKGDKGKPYLS*
Ga0138258_103849723300012413Polar MarineMVEMFKKSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPLENLNAKDHNKKIMTIEPPTDYQINT*
Ga0138258_173031933300012413Polar MarineMVEMFKRSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPLENLNAKDHNKKIMTIEPPTDY*
Ga0138264_129709023300012414Polar MarineMVAMFKRSKFFLVVANKMSYEDGICFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPLENLNAKDHNKKIMTIEPPTDY*
Ga0129347_117437013300012504AqueousMVELFKRSKFYLSVASKMSYDEGMVFTENNIVQYLAELEEYICSLITYSAFKREDPAAAISAIPLQQLNVKDNSKREAEEGPYGKIDYAQLRQF*
Ga0138268_103610613300012782Polar MarineMLEMFKRSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPLENLNAKDHNKKIMTIEPPTDY*
Ga0138268_103843223300012782Polar MarineMFRKIQGQVGTMVRMFKESKFFLVVAQKMNYDNGIVFTENNIVSYLAELEEYISSLITYTAFKRDDPNAPISSI
Ga0138268_161566013300012782Polar MarineHMFKRSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKREDANAPISSITLEKLNTKEFSKKTMFIDAPIAY*
Ga0163111_1212478213300012954Surface SeawaterQIMVELFKRSKFFLSVASKMSYDDGIVFTENNIVAYLAELEEHICSLVTYSAFKKDDPNAAISAIPLTQLNHKEFGKKELDIEAPNAQSYSDPTLERNFDNFTEKQYLEYF*
Ga0186523_10324453300017166Host-AssociatedMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYIGSLITYMAFKRDDPNAATSAIPLAQLNEKKFGQRDLDIDLNSIPAKPQREDPVLE
Ga0186339_10442653300017210Host-AssociatedMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYIGSLITYMAFKRDDPNAATSAIPLAQLNEKKFGQRDLEIDLNSIPAKPQREDPVLE
Ga0181583_1054328623300017952Salt MarshMMVEMFKRSKFYLSVATKMNYDEGFIFSESNIVSFLAELEEYICSLITYTAFKRDDPQAAIAAIPLDRLYPKSFN
Ga0181590_1100907013300017967Salt MarshKRSKFYLSVATKMNYDEGFIFSESNIVSFLAELEEYICSLITYTAFKRDDPQAAIAAIPLDRLYPKSFN
Ga0181566_1051064313300018426Salt MarshMVDMFKKSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKREDANAPISSIPLEKLNTKEFSKKTMFVSIFFRYF
Ga0193236_106024323300018698MarineMVELFKRSKFFLSVASRMSYDDGIVYTENNIVSYLAELEEHICSLITYSAFKKDDPNAAISAIPLNQLNHKE
Ga0192974_100067643300018739MarineMVEAFVSTKFFLSVAAKMNYDDGIVFTENNIVAYLAELEEYVGSLITYMAYKRDDQNAATSAIPLAQLNEKKFGQRDLEIDFN
Ga0193530_109489733300018770MarineMVEAFVATHFFLSVASKMNYDDGIVFTENNIVQYLAELEEYIGSLITYMAYKKDDPNAATSAIPLAQLN
Ga0192978_102843023300018871MarineMFRKVQQHVEMMVEMFKRSKFYLSVATKMNYDEGFIFSESNIVSFLAELEEYICSLITYTAFKRDDP
Ga0192978_103314423300018871MarineMVDMFKRSKFFLCVAQKQNYEDGIIFTENNIVSYLAELEEYISSLITYSAFKRDEPNAAIASIPLDRLTAKDFQ
Ga0193260_1009319423300018928MarineMVDMFKRSKFFLCVAQKQNYEDGIIFTENNIVSYLAELEEYISSLITYSAFKRDEPNAAIASIPLDRLTAKDF
Ga0193531_1001952313300018961MarineVATHFFLSVASKMNYDDGIVFTENNIVQYLAELEEYIGSLITYMAYKKDDPNAATSAIPLAQLNEKKFGTRDLEIDPAVINALKPPEDPGLEEA
Ga0193540_1003074613300018979MarineMVEAFVATHFFLSVASKMNYDDGIVFTENNIVQYLAELEEYIGSLITYMAYKKDDPNAATSAIPLAQLNEKKFGTRDLEIDPAVINALKPPEDPGLEEA
Ga0192947_1005267833300018982MarineMVDMFKQSKFFLCVAQKQNYQNGIIFTENNIVSYLAELEEYMSSLITYTAFKKEDPNAPICSIPLEKLNNKNFQQAKINIDPPTDWEPK
Ga0192916_1017979033300018996MarineVEAFVSTKFFLSVASKMNYDDGIVFTENNIVSYLAELEEYIGSLVTYMAFKRDDPNAATSAIPLA
Ga0193516_1028971013300019031MarineMVDLFKKSKFFLCVAQKQNYEDGITFTENNIVSYLAELEEYISSLITYSAFKRDEPNAAIASIPLDRLTAKDF
Ga0192945_1002417233300019036MarineMVHMFKRSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKREDANAPISSIPLEKLNTKEFSKKTMFIDAPIDYQIVNKNEGQDVG
Ga0192886_1027326013300019037MarineMVELFKKSKFFLSVASKMSYDDGIVFTENNIVAYLAELEEHICSLVTYSAFKKDDPNAAISAIPLTQLNHKEFGKKELDIEAPNPQSYSDP
Ga0193336_1019335923300019045MarineMVEMFKKSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPLENLNAKDHNKKVM
Ga0192981_1012564013300019048MarineMVEMFKRSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPLENLNAKDHNKKIMTIEPPTDY
Ga0192981_1014687013300019048MarineMVEMFKKSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPLENLNAKDHNKKIMTIEPPTDY
Ga0192981_1034769223300019048MarineMVEMFKRSKFHLAVATKMDYDEGFVFTENNIVQYLAELEEYINTLIVYTAFKKDDPNAAISAIPFESLN
Ga0192826_1036040313300019051MarineMFQRIQQHVNTMVDLFKKSKFFLCVAQKQNYEDGITFTENNIVSYLAELEEYISSLITYSAFKRDEPNAAIASIPLDRLTAKDF
Ga0192888_1025310723300019151MarineMVELFKRSKFFLSVASKMSYDDGIVYTENNIVSYLAELEEHICSLITYSAFKKDDPNAAISAIPLNQLNSKEFGKKELDIEPP
Ga0207193_135648013300020048Freshwater Lake SedimentMVEMFKRSKFFLCVAQMQSYSDGITFTENNIVQYLAELEEYISSLITYTAFKREDPNAAISSIPL
Ga0211734_1006306023300020159FreshwaterMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYIGSLVTYMAFKKDDPNAATSVIPLAQLNEKKFGQRDLDVSSPIFSN
Ga0206687_196499323300021169SeawaterMVEMFKRSKFFLVVAQKMNYDNGIIFTENNIVSYLAELEEYNSSLITYTAFKKDDPNAPISSIPLENLNAKDHQKKPMTIEAPIDYQIT
Ga0206693_147526023300021353SeawaterMVAMFKRSKFSLAVATQMDYDEGFVFTENNIVAYLAELEEYINTLIVYMAFKRDDPNAAIAAIPFES
Ga0256752_106576223300023439Hydrothermal Fe-Rich MatMFKQSRFFLSVAQKMTYEDGFVFTENNVVQYLAELEEYISSLITYTAFKRDEPNAAVSAIPLERLPQKEFNKRDMQIDPSVDAHWN
Ga0257021_102378313300023500MarineMEIERSNIEYREVKETFSKAQEYVEKMVVMFKQSRFFLSVAQKMTYEDGFIFTENNIVQYLAELEEYISSLITYTAFKKDEPNAAVSAIPLERLP
Ga0208005_102461323300025848AqueousMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVSYLSELEEYIGSLIQYMAFKRDDPNAATSVIPFAQLNEKKFG
Ga0209308_1040041413300025869Pelagic MarineHVETMVKMFKQSKFFLCVAQRMNYEDGITFTENNIVQYLAELEEYISSLITYNAFKRDEPNAAISSIPLEKLNQKDF
Ga0208544_1008659433300025887AqueousVMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYVGSLITYMAFKRDDPNAATSAIPLA
Ga0208544_1023932813300025887AqueousMVDMFKRSKFFLCVAQKMNYQDGIVFTENNIVSYLAELEEYISSLITYTAFKRDEPNAAISSIPLDKLEVKEFQKLKTTID
Ga0208544_1025075613300025887AqueousAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYIGSLITYMAFKRDDPNAATSAIPLA
Ga0209631_1014441743300025890Pelagic MarineMFKRSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKREDANAPISSIPLEKLNTKEFSKKTMFVSITSYYLN
Ga0209617_1028533213300027720Freshwater And SedimentMFRKVQQHVEMMVEMFKRSKFYLSVATKMNYDEGFIFSESNIVSFLAELEEYICSLITYTAFKRDD
Ga0209084_108884033300027749Freshwater LakeMFKKVQSSVSAMVEMFKRSKFFLCVAQMQSYSDGIAFTENNIVQYLAELEEYISSLITYTAFKREDPNAAISSIPLEKLNKKEF
Ga0207421_1029904913300027784Alkaline SedimentVKETSNSKKMFRKIQGYVEKMVELFKRSKFFLSVAQKMSYEEGFVFNESNIIPYLAELEEYISSLITYVAFKREDPNAAISSIPLEKLNQKDF
Ga0209812_1013744613300027786Wastewater EffluentMVEFFKRSRFFLSVAQKMSYDEGFTFNESNIVQYLAELEEYISSLITYTAFKKDDPNAAISAIPLEKLN
Ga0209302_1020103333300027810MarineMVDMFKRSKFFLCVAQKQNYEDGITFTENNIVSYLAELEEYISSLITYSAFKRDEPNAAIASIPLDRLTAKDFQ
Ga0209092_1010825923300027833MarineMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVSYLAELEEYISSLVTYMAFKRDDPNAATSAIPLQ
Ga0209712_1058408913300027849MarineMVEMFKRSKFFLVVANKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKKDDPNAPISSIPLENLNAKDHNKKIMTIEPPTDYQINT
Ga0209450_1011196643300027885Freshwater Lake SedimentVMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYISSLVTYMAFKKDDPNAVTSAIPLAQLNEKKFG
Ga0209668_1038882223300027899Freshwater Lake SedimentMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYISSLVTYMAFKKDDPNAVTSAIPLAQLNEKKFG
Ga0209298_1039399213300027973Freshwater LakeVSAMVEMFKRSKFFLCVAQMQSYSDGIAFTENNIVQYLAELEEYISSLITYTAFKREDPNAAISSIPLEKLNKKEF
Ga0073974_170232213300031005MarineMFKKIQESVELMVNMFKRSKFSLAVATQMDYDNDFTFTENNIVAYLAELEEYINTLIVYMAFKRDEPNAAIAAIP
Ga0138347_1109923833300031113MarineMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVSYLAELEEYIGSLVTYMAFKRDDPNAATSAIPLA
Ga0307993_119412413300031602MarineMVAMFKRSKFSLAVATQMDYDEGFVFTENNIVAYLAELEEYINTLIVYMAFKRDDPNAAIAAIP
Ga0302121_1004051213300031626MarineMNYEDGIGFTENNIVSYLAELEEYISSLITYNAFKREDPNAAISSIPLDQLQEKQFVKKKDQFDAPIDYTINNQDGQQTP
Ga0307396_1033511813300031717MarineMVEMFKRSKYHLAVATKMDYDEGFVFTENNIVQYLAELEEYINTLIVYTAFKKDDPNAAISAIPFE
Ga0315906_1109045013300032050FreshwaterMFKKVQSSVGAMVEMFKRSKFFLCVAQMQSYSDGITFTENNIVQYLAELEEYISSLITYTAFKREDPNAAISSIPLEKLNKKEF
Ga0315270_1008214633300032275SedimentMVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYIGSLVTYMAFKKDDPNAATSVIPLAQLNEKKFGQRDLDVSSLIFSN
Ga0314684_1023618823300032463SeawaterMVDMFKKSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKREDANAPISSIPLEKLNTKEFSKKTMFLEPPIDYTIINKESNIEGTAVEEGL
Ga0314712_1037503913300032747SeawaterMVDMFKKSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKREDANAPISSIPLEKL
Ga0314691_1005869343300032749SeawaterMVDMFKKSKFFLCVAQKMNYEDGITFTENNIVSYLAELEEYISSLITYTAFKREDANAPISSIPLEKLNTKEFSKKTMFLEPPIDYTIINKESNIEGTAVE
Ga0315742_1287409813300032756Forest SoilMFRKVQQHVEKMVEMFKKSKFFLAVAQKMSYDEGFHFNESNIVQYLAELEEYISSLFTYTAFKRDDPNAAISAIPLEKLN
Ga0310342_10279747223300032820SeawaterMVEMFKRSKFHLAVATKMDYDEGFVFTENNIVQYLAELEEYINTLIVYTAFKRDDPNAAISAIPFESLN
Ga0334989_0153729_746_9673300033984FreshwaterMVEMFKRSKFFLCVAQMQSYSDGITFTENNIVQYLAELEEYISSLITYTAFKREDPNAAISSIPLEKLNKKEF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.