NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F085323

Metagenome Family F085323

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085323
Family Type Metagenome
Number of Sequences 111
Average Sequence Length 48 residues
Representative Sequence MRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGETTAKCIVAIGKG
Number of Associated Samples 80
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.57 %
% of genes near scaffold ends (potentially truncated) 26.13 %
% of genes from short scaffolds (< 2000 bps) 64.86 %
Associated GOLD sequencing projects 66
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (56.757 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(24.324 % of family members)
Environment Ontology (ENVO) Unclassified
(29.730 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(65.766 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 61.22%    β-sheet: 0.00%    Coil/Unstructured: 38.78%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF09828Chrome_Resist 5.41
PF00174Oxidored_molyb 3.60
PF07589PEP-CTERM 2.70
PF160782-oxogl_dehyd_N 2.70
PF00491Arginase 1.80
PF13472Lipase_GDSL_2 1.80
PF04952AstE_AspA 1.80
PF00033Cytochrome_B 0.90
PF02772S-AdoMet_synt_M 0.90
PF01292Ni_hydr_CYTB 0.90
PF11006DUF2845 0.90
PF00903Glyoxalase 0.90
PF02371Transposase_20 0.90
PF02368Big_2 0.90
PF00266Aminotran_5 0.90
PF01695IstB_IS21 0.90
PF13560HTH_31 0.90
PF14534DUF4440 0.90
PF13520AA_permease_2 0.90
PF00413Peptidase_M10 0.90
PF02518HATPase_c 0.90
PF01544CorA 0.90
PF01464SLT 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 3.60
COG3915Uncharacterized conserved proteinFunction unknown [S] 3.60
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 1.80
COG0192S-adenosylmethionine synthetaseCoenzyme transport and metabolism [H] 0.90
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 0.90
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 0.90
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.90
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 0.90
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 0.90
COG3038Cytochrome b561Energy production and conversion [C] 0.90
COG3547TransposaseMobilome: prophages, transposons [X] 0.90
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 0.90
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 0.90
COG5549Predicted Zn-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms56.76 %
UnclassifiedrootN/A43.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886013|SwBSRL2_contig_479110All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium933Open in IMG/M
3300003371|JGI26145J50221_1024936All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas593Open in IMG/M
3300004114|Ga0062593_102469209Not Available588Open in IMG/M
3300004157|Ga0062590_101581602Not Available662Open in IMG/M
3300004463|Ga0063356_100051671All Organisms → cellular organisms → Bacteria4147Open in IMG/M
3300004463|Ga0063356_101581306All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylomonas975Open in IMG/M
3300004463|Ga0063356_103616820Not Available666Open in IMG/M
3300004643|Ga0062591_100428439All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1106Open in IMG/M
3300004643|Ga0062591_101433915Not Available687Open in IMG/M
3300005093|Ga0062594_100537479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1002Open in IMG/M
3300005328|Ga0070676_10118769All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300005347|Ga0070668_100330823All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1285Open in IMG/M
3300005353|Ga0070669_101959126Not Available512Open in IMG/M
3300005366|Ga0070659_101015837All Organisms → cellular organisms → Bacteria → Proteobacteria728Open in IMG/M
3300005441|Ga0070700_101638953Not Available550Open in IMG/M
3300005457|Ga0070662_100123045Not Available1990Open in IMG/M
3300005459|Ga0068867_100099314All Organisms → cellular organisms → Bacteria2220Open in IMG/M
3300005543|Ga0070672_100090537All Organisms → cellular organisms → Bacteria2467Open in IMG/M
3300005545|Ga0070695_101887371Not Available502Open in IMG/M
3300005719|Ga0068861_100195927All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1692Open in IMG/M
3300005719|Ga0068861_101171107Not Available742Open in IMG/M
3300005840|Ga0068870_10053237All Organisms → cellular organisms → Bacteria2149Open in IMG/M
3300006844|Ga0075428_100028272All Organisms → cellular organisms → Bacteria6201Open in IMG/M
3300006844|Ga0075428_100075794All Organisms → cellular organisms → Bacteria → Proteobacteria3673Open in IMG/M
3300006844|Ga0075428_100204627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2133Open in IMG/M
3300006845|Ga0075421_100136356All Organisms → cellular organisms → Bacteria3073Open in IMG/M
3300006845|Ga0075421_100195688All Organisms → cellular organisms → Bacteria2505Open in IMG/M
3300006846|Ga0075430_100007548All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria9182Open in IMG/M
3300006846|Ga0075430_100040411Not Available3948Open in IMG/M
3300006846|Ga0075430_100062093All Organisms → cellular organisms → Bacteria → Proteobacteria3139Open in IMG/M
3300006847|Ga0075431_100136897All Organisms → cellular organisms → Bacteria2525Open in IMG/M
3300006847|Ga0075431_100208279Not Available1998Open in IMG/M
3300006847|Ga0075431_100630781Not Available1053Open in IMG/M
3300006853|Ga0075420_101311155Not Available621Open in IMG/M
3300006876|Ga0079217_10058330Not Available1582Open in IMG/M
3300006876|Ga0079217_11272727Not Available565Open in IMG/M
3300006880|Ga0075429_100100440All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium2525Open in IMG/M
3300006881|Ga0068865_100092374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2198Open in IMG/M
3300006894|Ga0079215_10078214Not Available1386Open in IMG/M
3300006918|Ga0079216_10747146Not Available707Open in IMG/M
3300006969|Ga0075419_10605982Not Available770Open in IMG/M
3300006969|Ga0075419_10618556All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium762Open in IMG/M
3300007004|Ga0079218_10026381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3283Open in IMG/M
3300007004|Ga0079218_10055184Not Available2495Open in IMG/M
3300007004|Ga0079218_10131347All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1790Open in IMG/M
3300009100|Ga0075418_10018808All Organisms → cellular organisms → Bacteria → Proteobacteria7630Open in IMG/M
3300009100|Ga0075418_10034836All Organisms → cellular organisms → Bacteria5464Open in IMG/M
3300009100|Ga0075418_10116040All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium2843Open in IMG/M
3300009100|Ga0075418_10587700Not Available1198Open in IMG/M
3300009147|Ga0114129_10732633All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium1267Open in IMG/M
3300009147|Ga0114129_11161548Not Available963Open in IMG/M
3300009156|Ga0111538_10319320Not Available1965Open in IMG/M
3300009157|Ga0105092_10007839All Organisms → cellular organisms → Bacteria5620Open in IMG/M
3300009553|Ga0105249_11914098Not Available666Open in IMG/M
3300010399|Ga0134127_10224835All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1761Open in IMG/M
3300012892|Ga0157294_10126983Not Available685Open in IMG/M
3300012905|Ga0157296_10008898Not Available1658Open in IMG/M
3300012905|Ga0157296_10019904Not Available1301Open in IMG/M
3300013096|Ga0157307_1125377Not Available573Open in IMG/M
3300015077|Ga0173483_10982555Not Available504Open in IMG/M
3300018469|Ga0190270_10052282All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus2849Open in IMG/M
3300018469|Ga0190270_12808471All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300018481|Ga0190271_10703712All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1133Open in IMG/M
3300018481|Ga0190271_12221095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium655Open in IMG/M
3300022901|Ga0247788_1056537Not Available735Open in IMG/M
3300023057|Ga0247797_1005775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1367Open in IMG/M
3300025885|Ga0207653_10244390All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300025893|Ga0207682_10175457Not Available977Open in IMG/M
3300025899|Ga0207642_10798893Not Available600Open in IMG/M
3300025907|Ga0207645_10010126All Organisms → cellular organisms → Bacteria → Proteobacteria6488Open in IMG/M
3300025907|Ga0207645_10034845Not Available3234Open in IMG/M
3300025907|Ga0207645_10041927All Organisms → cellular organisms → Bacteria2929Open in IMG/M
3300025908|Ga0207643_10013388All Organisms → cellular organisms → Bacteria → Proteobacteria4442Open in IMG/M
3300025923|Ga0207681_10041874Not Available3056Open in IMG/M
3300025930|Ga0207701_10009777All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans9448Open in IMG/M
3300025930|Ga0207701_10026283All Organisms → cellular organisms → Bacteria → Proteobacteria5530Open in IMG/M
3300025934|Ga0207686_11022604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300025937|Ga0207669_10010216All Organisms → cellular organisms → Bacteria4511Open in IMG/M
3300025938|Ga0207704_10500007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium980Open in IMG/M
3300025938|Ga0207704_11395693Not Available600Open in IMG/M
3300025940|Ga0207691_10004840All Organisms → cellular organisms → Bacteria → Proteobacteria13018Open in IMG/M
3300025972|Ga0207668_10109055All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2073Open in IMG/M
3300025972|Ga0207668_11536116Not Available601Open in IMG/M
3300026075|Ga0207708_10236376All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1468Open in IMG/M
3300026116|Ga0207674_12288182Not Available503Open in IMG/M
3300026811|Ga0207529_101232All Organisms → cellular organisms → Bacteria → Proteobacteria816Open in IMG/M
3300027252|Ga0209973_1059510All Organisms → cellular organisms → Bacteria → PVC group586Open in IMG/M
3300027364|Ga0209967_1002987Not Available2216Open in IMG/M
3300027421|Ga0207563_101123Not Available824Open in IMG/M
3300027614|Ga0209970_1029582Not Available949Open in IMG/M
3300027637|Ga0209818_1189567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300027691|Ga0209485_1193465Not Available630Open in IMG/M
3300027722|Ga0209819_10146395All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300027880|Ga0209481_10170748All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300027886|Ga0209486_10005631All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium5439Open in IMG/M
3300027886|Ga0209486_10103857All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1512Open in IMG/M
3300027909|Ga0209382_10111221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3201Open in IMG/M
3300027909|Ga0209382_10147332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2729Open in IMG/M
3300027909|Ga0209382_10247279All Organisms → cellular organisms → Bacteria2026Open in IMG/M
3300027909|Ga0209382_11935379Not Available568Open in IMG/M
3300028380|Ga0268265_10177014All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_60_91829Open in IMG/M
3300028587|Ga0247828_10148697Not Available1172Open in IMG/M
3300031538|Ga0310888_10660135Not Available639Open in IMG/M
3300031562|Ga0310886_10015432All Organisms → cellular organisms → Bacteria2927Open in IMG/M
3300031847|Ga0310907_10625376Not Available589Open in IMG/M
3300031892|Ga0310893_10158079Not Available886Open in IMG/M
3300031908|Ga0310900_11594231Not Available552Open in IMG/M
3300031913|Ga0310891_10051500Not Available1155Open in IMG/M
3300031943|Ga0310885_10012633All Organisms → cellular organisms → Bacteria2957Open in IMG/M
3300032122|Ga0310895_10199606Not Available898Open in IMG/M
3300034176|Ga0364931_0060126All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1164Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere24.32%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil9.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.11%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere7.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.31%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere6.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere6.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.70%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.90%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300003371Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PMHost-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026811Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A4w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027421Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A2-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwBSRL2_0918.000001102162886013Switchgrass RhizospherePVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG
JGI26145J50221_102493623300003371Arabidopsis Thaliana RhizosphereVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG*
Ga0062593_10246920923300004114SoilMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGETTAKCVVTIGKG*
Ga0062590_10158160223300004157SoilMRSRTGQRVPVWLQMIVVVVCATAMVIAADAADHCGETTAQCIVAISNG*
Ga0063356_10005167153300004463Arabidopsis Thaliana RhizosphereMRSRTGQRVPVWLQMIVVVVCATAMVIAADAEGYCGETTAKCLVAIGKG*
Ga0063356_10158130623300004463Arabidopsis Thaliana RhizosphereMRSRAGQRVPVWLQVIVVVVCATAMVIAADAEDYCGEITAKCIVAIGQG*
Ga0063356_10361682013300004463Arabidopsis Thaliana RhizosphereVPVWLQIIVVVVCATAMVIAADAEDHCGETAAKCIVAIGKG*
Ga0062591_10042843913300004643SoilMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG*
Ga0062591_10143391513300004643SoilMDGYRRMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGATNAKCIVAIGKA*
Ga0062594_10053747923300005093SoilMRSRAGQRVPVWLQVIVVVVWATAMVIAAGANDYCGETTAKCIVAIGQGLTGS*
Ga0070676_1011876923300005328Miscanthus RhizosphereMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGETTAKCIVAIGKG*
Ga0070668_10033082333300005347Switchgrass RhizosphereECRRMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG*
Ga0070669_10195912613300005353Switchgrass RhizosphereMRSRAGQRVPVWLQVIVVVVWATAMVIAAGANDYCGETTAKCIVAIG
Ga0070659_10101583713300005366Corn RhizosphereMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVVIGKG*
Ga0070700_10163895323300005441Corn, Switchgrass And Miscanthus RhizosphereRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCSVGIGKG*
Ga0070662_10012304543300005457Corn RhizosphereMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVGIGKG*
Ga0068867_10009931413300005459Miscanthus RhizosphereSDQCRRMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG*
Ga0070672_10009053733300005543Miscanthus RhizosphereMRSRAGQRVPVWLQIIVVVVFATAMVIAADAEDHCGETTAGCIVAIGKG*
Ga0070695_10188737113300005545Corn, Switchgrass And Miscanthus RhizosphereMDGYRRMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDRCGATNAKCIVAIGKA*
Ga0068861_10019592723300005719Switchgrass RhizosphereVPVWLQIIVVVVCATAMVIAADAEDHCGETTAGCIVAIGKG*
Ga0068861_10117110713300005719Switchgrass RhizosphereMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGATNAKCIVAIGKA*
Ga0068870_1005323743300005840Miscanthus RhizosphereRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG*
Ga0075428_10002827253300006844Populus RhizosphereMRFRAGQRVPVWLQMIVVVVCATAMVIAADAEDYCGETTAKCIVAIGKG*
Ga0075428_10007579443300006844Populus RhizosphereMRSRAGQRVPVWLQMIVVVVCATAMVIAADAKNYCGETTAKCLVGIGKG*
Ga0075428_10020462753300006844Populus RhizosphereMRSRAGQRVPVWLQVIVVVVCATAMVIAADTEDYCGEITARCIVAIGQG*
Ga0075421_10013635613300006845Populus RhizosphereMRFRAGQRVPVWLQMIVVVVCATAMVIAADAEDSCGETSAKCIVAIGKG*
Ga0075421_10019568843300006845Populus RhizosphereMRSRAGQRVPLWLQIIVVVVWATAMVIAADAEDHCGETTAKCMVAIGKG*
Ga0075430_10000754843300006846Populus RhizosphereMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVAIGKG*
Ga0075430_10004041163300006846Populus RhizosphereMDGYRRMRARAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGATNAKCIVAIGKA*
Ga0075430_10006209373300006846Populus RhizosphereMRFRAGQRVPVWLQMIVVVVCATAMVIAADAEGSCGETSAKCIVAIGKG*
Ga0075431_10013689743300006847Populus RhizosphereMRSRAGQRVPVWLQVIVVVVCATAMVIAADTEDYCGEITAKCIVAIGQG*
Ga0075431_10020827923300006847Populus RhizosphereVPVWLQIIVVVVCATAMVIAADAEDHCGETTAKCMVAIGKG*
Ga0075431_10063078123300006847Populus RhizosphereMRFRAGQRVPVWLQMIVVVVCATAMVIAADAEDYCGETTAKCIVAIGRG*
Ga0075420_10131115513300006853Populus RhizosphereMRCRRMRFRAGQRVPVWLQMIVVVVCATAMVIAADAEDYCGETTAKCIVAIGRG*
Ga0079217_1005833033300006876Agricultural SoilMRCRRMRSGAGQRVPLWLQMGAVVVCATAMVIAADAEDCGETAAKCVVAIDKG*
Ga0079217_1127272723300006876Agricultural SoilMRSRAGQGVPIWLQVIVVVVCATAMVIGADAEDNCGETTAKCIVAIGKG*
Ga0075429_10010044013300006880Populus RhizosphereRVPVWLQIIVVVVCATAMVIAADAEDHCGATNAKCIVAIGKA*
Ga0068865_10009237433300006881Miscanthus RhizosphereMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGETTAGCIVAIGKG*
Ga0079215_1007821413300006894Agricultural SoilMRCRRMRSGAGQRVPLWLQMVVVVVCATAMVIAADAEDCGETTAKCVVAIDKG*
Ga0079216_1074714623300006918Agricultural SoilMRSGAGQRVPLWLQMVVVVVCATAMVIAADAEDCGETTANCVVAIDKG*
Ga0075419_1060598213300006969Populus RhizosphereMRCRRMRFRAGQRVPVWLQMIVVVVCATAMVIAADAEDYCGETTAKCIVAIGKG*
Ga0075419_1061855623300006969Populus RhizosphereVWLQVIVVVVCATAMVIAADTEDYCGEITARCIVAIGQG*
Ga0079218_1002638153300007004Agricultural SoilMRCRRMRFRAGQRVPVWLQMIVVVVCATAMVIAADAEDYCGETTAKCIVAIDRG*
Ga0079218_1005518443300007004Agricultural SoilMRSRAGQRVPVWLQVIVVVVCATAMVIAADAEDYCGEITAKCIVAIGKG*
Ga0079218_1013134723300007004Agricultural SoilMRSGAGQRVPLWLQMVAVVVCATAMVIAADAEDCGETAAKCVVAIDKG*
Ga0075418_10018808123300009100Populus RhizosphereMIVVVVCATAMVIAADAEDYCGETTAKCIVAIGRG*
Ga0075418_1003483643300009100Populus RhizosphereVPVWLQIIVVVVCATAMVIAADAEDHCGETTAKCIVAIGKG*
Ga0075418_1011604023300009100Populus RhizosphereMIVVVVCATAMVIAADAKNYCGEATAKCLVGIGKG*
Ga0075418_1058770033300009100Populus RhizosphereMDGYRRMRARAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGETNAKCIVAIGKA*
Ga0114129_1073263323300009147Populus RhizosphereMIVVVVCATAMVIAADAKNYCGETTAKCLVGIGKG*
Ga0114129_1116154823300009147Populus RhizosphereMDGYRRMRARAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGATNAKCIVAIGKV*
Ga0111538_1031932013300009156Populus RhizosphereRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVAIGKG*
Ga0105092_1000783973300009157Freshwater SedimentMRSREGQRVLVWLQMIIVVVCATAMVIAADAEDYCGETTAKCIVAIGKG*
Ga0105249_1191409823300009553Switchgrass RhizosphereMDGYRRMRARAGQRVPVWLQIIVVVVCATAMVIAADAEDRCGATNAKCIVAIGKA*
Ga0134127_1022483523300010399Terrestrial SoilMRSRAGQRVPVWLQIIVVVVFATAMVIAADAEDHCGDTTAKCIVSIGKG*
Ga0157294_1012698323300012892SoilMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDHCGETTAKCVVTIGKG*
Ga0157296_1000889833300012905SoilVPVWLQIIVVVVCATAMVIAADAEDHCGETTAKCVVTIGKG*
Ga0157296_1001990433300012905SoilWLQMIIVVVCATAMVIAADAEDYCGATAKCIVGIGKG*
Ga0157307_112537713300013096SoilRMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVGIGKG*
Ga0173483_1098255513300015077SoilVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAI
Ga0190270_1005228213300018469SoilMRFRAGQRVPVWLQMIVVVVCATAMVIAADAEDYCGETTAKCIVAIDRG
Ga0190270_1280847113300018469SoilMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVAIGKG
Ga0190271_1070371213300018481SoilMRARTGQRVPLWLQIIVVVVCATGLVIAADAEDYGAGTPAPCIVASGEG
Ga0190271_1222109513300018481SoilMRFRAGQRVPVWLQMIVVVVCATAMVIAADAADYCGQTSAKCIVAIGKG
Ga0247788_105653723300022901SoilMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVGIGKG
Ga0247797_100577513300023057SoilMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG
Ga0207653_1024439023300025885Corn, Switchgrass And Miscanthus RhizosphereMDGYRRMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVVIGKG
Ga0207682_1017545723300025893Miscanthus RhizosphereMRSRAGQRVPVWLQVIVVVVWATAMVIAAGANDYCGETTAKCIVAIGQGLTGS
Ga0207642_1079889313300025899Miscanthus RhizosphereMDGYRRMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGATNAKCIVAIGKA
Ga0207645_1001012663300025907Miscanthus RhizosphereMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVVIGKG
Ga0207645_1003484513300025907Miscanthus RhizosphereMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGATNAKCIVAIGKA
Ga0207645_1004192733300025907Miscanthus RhizosphereMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGETTAKCIVAIGKG
Ga0207643_1001338853300025908Miscanthus RhizosphereCRRMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGETTAGCIVAIGKG
Ga0207681_1004187433300025923Switchgrass RhizosphereMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGETTAKCVVTIGKG
Ga0207701_1000977713300025930Corn, Switchgrass And Miscanthus RhizosphereVPVWLQIIVVVVCATAMVIAADAEDHCGATNAKCIVAIGKA
Ga0207701_1002628363300025930Corn, Switchgrass And Miscanthus RhizosphereRSRAGQRVPVWLQIIVVVVFATAMVIAADAEDHCGETTAGCIVAIGKG
Ga0207686_1102260423300025934Miscanthus RhizospherePVLSRISDGVCGRMRSRAGQRVPVWLQVIVVVVWATAMVIAADAEDHCGETTAGCIVAIGKG
Ga0207669_1001021633300025937Miscanthus RhizosphereVPVWLQIIVVVVCATAMVIAADAEDHCGETTAGCIVAIGKG
Ga0207704_1050000713300025938Miscanthus RhizosphereECRRMRSRAGQRVPVWLQIIVVVVFATAMVIAADAEDHCGETTAGCIVAIGKG
Ga0207704_1139569313300025938Miscanthus RhizosphereMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVA
Ga0207691_10004840153300025940Miscanthus RhizosphereMRSRAGQRVPVWLQIIVVVVFATAMVIAADAEDHCGETTAGCIVAIGKG
Ga0207668_1010905513300025972Switchgrass RhizosphereRMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG
Ga0207668_1153611613300025972Switchgrass RhizosphereGMDGYRRMRARAGQRVPVWLQIIVVVVCATAMVIAADAEDRCGATNAKCIVAIGKA
Ga0207708_1023637653300026075Corn, Switchgrass And Miscanthus RhizosphereRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCSVGIGKG
Ga0207674_1228818223300026116Corn RhizosphereMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCI
Ga0207529_10123223300026811SoilVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG
Ga0209973_105951013300027252Arabidopsis Thaliana RhizosphereRISGECRRMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVGIGKG
Ga0209967_100298753300027364Arabidopsis Thaliana RhizosphereMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVGIG
Ga0207563_10112313300027421SoilMRSRAGQRVPVWLQMIIVVVCATAMVIAADAEDHCGETTAKCVVTIGKG
Ga0209970_102958223300027614Arabidopsis Thaliana RhizosphereMRSRAGQRVPVWLQIIVVVVCATAMVIAADAKDHCGATNAKCILAIGKA
Ga0209818_118956723300027637Agricultural SoilMRSRAGQGVPIWLQVIVVVVCATAMVIGADAEDNCGETTAKCIVAIGKG
Ga0209485_119346513300027691Agricultural SoilMRSGAGQRVPLWLQMVVVVVCATAMVIAADAEDCGETTANCVVAIDKG
Ga0209819_1014639523300027722Freshwater SedimentMRSREGQRVLVWLQMIIVVVCATAMVIAADAEDYCGETTAKCIVAIGKG
Ga0209481_1017074823300027880Populus RhizosphereVPVWLQIIVVVVCATAMVIAADAEDHCGETTAKCIVAIGKG
Ga0209486_1000563133300027886Agricultural SoilMRSRAGQRVPVWLQVIVVVVCATAMVIAADAEDYCGEITAKCIVAIGKG
Ga0209486_1010385723300027886Agricultural SoilMRSGAGQRVPLWLQMVAVVVCATAMVIAADAEDCGETAAKCVVAIDKG
Ga0209382_1011122153300027909Populus RhizosphereMRFRAGQRVPVWLQMIVVVVCATAMVIAADAEDYCGETTAKCIVAIGRG
Ga0209382_1014733223300027909Populus RhizosphereMRSRAGQRVPLWLQIIVVVVWATAMVIAADAEDHCGETTAKCMVAIGKG
Ga0209382_1024727923300027909Populus RhizosphereMRSRAGQRVPVWLQVIVVVVCATAMVIAADTEDYCGEITARCIVAIGQG
Ga0209382_1193537913300027909Populus RhizosphereMRSRAGQRVPVWLQMIVVVVCATAMVIAADAKNYCGETTAKCLVGIGKG
Ga0268265_1017701413300028380Switchgrass RhizosphereMRSRAGQRVPVWLQIIVVVVFATAMVIAADAEDHCGETTAGCIVAIGK
Ga0247828_1014869713300028587SoilMRSRAGQRVPVWLQIIVVVVCATAMDIAADAEDHCGETTAKCVVTIGKG
Ga0310888_1066013513300031538SoilMRSRAGQRVPVWLQMIVVVVCATAMVIAADAKDYCGETAKCIVASGKG
Ga0310886_1001543213300031562SoilLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG
Ga0310907_1062537613300031847SoilVPVWLQIIVVVVCATAMVIAADAEDHCGETTAKCVVTIGKG
Ga0310893_1015807913300031892SoilMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGETTAGCIVAIGKG
Ga0310900_1159423123300031908SoilYRRMRFRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGATNAKCIVAIGKA
Ga0310891_1005150023300031913SoilVPVWLQMIIVVVCATAMVIAADAEDYCGATAKCIVGIGKG
Ga0310885_1001263313300031943SoilDQCRRMRSRAGQRVPVWLQIIVVVVCATAMVIAADAEDHCGDTTAKCIVAIGKG
Ga0310895_1019960613300032122SoilMRSRAGQRVPVWLQIIVVVVCATAMVIAADADAEDHCGATNAKCIVAIGKA
Ga0364931_0060126_114_2213300034176SedimentMIIVVVCATAMVIAADAEGHCGETTAKCIVAIGKG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.