NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F093679

Metagenome Family F093679

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093679
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 44 residues
Representative Sequence MRLSSQLLLTFLLNACWQVALIAALASLGSWLLRNSTARYRHW
Number of Associated Samples 90
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.09 %
% of genes near scaffold ends (potentially truncated) 94.34 %
% of genes from short scaffolds (< 2000 bps) 92.45 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.396 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(9.434 % of family members)
Environment Ontology (ENVO) Unclassified
(36.792 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(56.604 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 57.75%    β-sheet: 0.00%    Coil/Unstructured: 42.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF03965Penicillinase_R 86.79
PF13858DUF4199 1.89
PF02687FtsX 0.94
PF02012BNR 0.94
PF04134DCC1-like 0.94
PF00196GerE 0.94
PF13519VWA_2 0.94
PF13231PMT_2 0.94
PF08281Sigma70_r4_2 0.94
PF15902Sortilin-Vps10 0.94
PF02667SCFA_trans 0.94
PF12838Fer4_7 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 86.79
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 86.79
COG2031Short chain fatty acids transporterLipid transport and metabolism [I] 0.94
COG2978p-Aminobenzoyl-glutamate transporter AbgTCoenzyme transport and metabolism [H] 0.94
COG3011Predicted thiol-disulfide oxidoreductase YuxK, DCC familyGeneral function prediction only [R] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.40 %
UnclassifiedrootN/A6.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_28070All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_103169604All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300000955|JGI1027J12803_106675312Not Available881Open in IMG/M
3300004114|Ga0062593_103423024All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae509Open in IMG/M
3300004156|Ga0062589_100344264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1179Open in IMG/M
3300004156|Ga0062589_100939795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae801Open in IMG/M
3300004156|Ga0062589_102039065All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300004157|Ga0062590_102511233All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300004463|Ga0063356_105623799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae538Open in IMG/M
3300004643|Ga0062591_102128716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis582Open in IMG/M
3300005293|Ga0065715_11090114All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300005331|Ga0070670_100051145All Organisms → cellular organisms → Bacteria3549Open in IMG/M
3300005333|Ga0070677_10418756All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300005337|Ga0070682_101809575All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300005340|Ga0070689_101301568All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300005341|Ga0070691_10666877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae621Open in IMG/M
3300005345|Ga0070692_10313766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae961Open in IMG/M
3300005345|Ga0070692_10549115All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300005365|Ga0070688_101819505All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae500Open in IMG/M
3300005438|Ga0070701_11281928All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300005458|Ga0070681_10298091All Organisms → cellular organisms → Bacteria1522Open in IMG/M
3300005543|Ga0070672_101413071All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300005549|Ga0070704_101731616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae578Open in IMG/M
3300005556|Ga0066707_10493460All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300005578|Ga0068854_102048448All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae528Open in IMG/M
3300005617|Ga0068859_103053174All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300005618|Ga0068864_100771236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia943Open in IMG/M
3300005841|Ga0068863_101007977All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae835Open in IMG/M
3300005841|Ga0068863_102159968All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300005841|Ga0068863_102746702All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae501Open in IMG/M
3300005843|Ga0068860_101695668All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300005985|Ga0081539_10052788All Organisms → cellular organisms → Bacteria2280Open in IMG/M
3300006755|Ga0079222_10519353All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300006806|Ga0079220_11989838All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300006844|Ga0075428_100207614All Organisms → cellular organisms → Bacteria2117Open in IMG/M
3300006845|Ga0075421_102155750All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300006894|Ga0079215_11357723All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300006904|Ga0075424_102188648All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300007004|Ga0079218_12771731All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300009093|Ga0105240_11463133All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300009094|Ga0111539_11959845All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300009098|Ga0105245_12089903All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300009147|Ga0114129_10741883All Organisms → cellular organisms → Bacteria → Acidobacteria1258Open in IMG/M
3300009147|Ga0114129_11488488All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300010037|Ga0126304_11008441All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300010039|Ga0126309_11299811All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300010040|Ga0126308_10957467All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300010041|Ga0126312_11133794All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300010042|Ga0126314_10024375All Organisms → cellular organisms → Bacteria3717Open in IMG/M
3300010043|Ga0126380_11986821All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300010358|Ga0126370_12322203All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300010360|Ga0126372_11698490All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300010362|Ga0126377_11671282Not Available712Open in IMG/M
3300010362|Ga0126377_13516827All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300010373|Ga0134128_10877824All Organisms → cellular organisms → Bacteria → Acidobacteria993Open in IMG/M
3300010399|Ga0134127_11229187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia817Open in IMG/M
3300010399|Ga0134127_12714865All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300010400|Ga0134122_12466835All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300010401|Ga0134121_11934001All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300012361|Ga0137360_11131939All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300012469|Ga0150984_110129264All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300013100|Ga0157373_11464643All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300013102|Ga0157371_11163354All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300013102|Ga0157371_11502303All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300013306|Ga0163162_12143496All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300013306|Ga0163162_12346540All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300013308|Ga0157375_11611823Not Available767Open in IMG/M
3300013754|Ga0120183_1019985All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300015200|Ga0173480_10858355All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300015241|Ga0137418_10214983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1652Open in IMG/M
3300015373|Ga0132257_100345373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1798Open in IMG/M
3300015374|Ga0132255_100295499All Organisms → cellular organisms → Bacteria2330Open in IMG/M
3300015374|Ga0132255_106168048All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300018476|Ga0190274_11297348All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300019362|Ga0173479_10759503All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300021560|Ga0126371_13451425All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300025321|Ga0207656_10549394All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300025904|Ga0207647_10252619All Organisms → cellular organisms → Bacteria → Acidobacteria1011Open in IMG/M
3300025920|Ga0207649_10900499All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300025922|Ga0207646_10530478All Organisms → cellular organisms → Bacteria → Acidobacteria1059Open in IMG/M
3300025926|Ga0207659_11791698All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300025938|Ga0207704_10980800All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300025938|Ga0207704_11108167All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300025941|Ga0207711_10913377All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300026035|Ga0207703_11550781All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300026041|Ga0207639_12005144All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300026088|Ga0207641_10651721All Organisms → cellular organisms → Bacteria → Acidobacteria1034Open in IMG/M
3300026088|Ga0207641_12203939All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300026089|Ga0207648_10884081All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300026118|Ga0207675_101924856Not Available610Open in IMG/M
3300027787|Ga0209074_10515482All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300027907|Ga0207428_11167655All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300028047|Ga0209526_10181276All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1465Open in IMG/M
3300028146|Ga0247682_1011562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1522Open in IMG/M
3300030496|Ga0268240_10138526All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300031455|Ga0307505_10320898All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300031548|Ga0307408_100683493All Organisms → cellular organisms → Bacteria → Acidobacteria921Open in IMG/M
3300031903|Ga0307407_10099093All Organisms → cellular organisms → Bacteria1805Open in IMG/M
3300031903|Ga0307407_11620988All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300031962|Ga0307479_10746632All Organisms → cellular organisms → Bacteria → Acidobacteria956Open in IMG/M
3300032012|Ga0310902_11108273All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300032126|Ga0307415_100535886All Organisms → cellular organisms → Bacteria → Acidobacteria1030Open in IMG/M
3300032180|Ga0307471_103942435All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere9.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.66%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.72%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.77%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.89%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.94%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013754Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_000745002199352025SoilMRNSSQLLLTFLLNACWQIALVAALASFSSWLLRNS
INPhiseqgaiiFebDRAFT_10316960423300000364SoilMRISSQLLLTFLLNACWQVALIAALASFGSWLMRNS
JGI1027J12803_10667531233300000955SoilSSQVLLTFLLNACWQIPLITLLAVCGARLLKTEVA
Ga0062593_10342302423300004114SoilMRISSELLLTFLLNACWQIALIVAFASFGSWLLRHAAARYQHWLWVATLCLSLLVPVT
Ga0062589_10034426433300004156SoilMRTISQLLLTFLLNSVWQVGLIASLALISAWLLRNSAARYR
Ga0062589_10093979513300004156SoilMRISSQLLLTFLLNACWQIALIAALAAIGSRWLRKSAARYHHWLWVSAL
Ga0062589_10203906523300004156SoilMRISSQLLLTFLLNAIWQVALIAALAALGSWLLRNSVARYRHWV
Ga0062590_10251123323300004157SoilMRMSSPLVLTFLLNALWQVALIAGLAASGSWLLRNSVARYRHWLWAS
Ga0063356_10562379913300004463Arabidopsis Thaliana RhizosphereMRMSSQLLLTFLLNAIWQVALIAALAALGAWLLRNSSARYRHWVWA
Ga0062591_10212871623300004643SoilMRISSQLLLTFLLNAVWQVALIAGLAACGSWLLRNSVARYRHWLWASALCLAFF
Ga0065715_1109011413300005293Miscanthus RhizosphereMKLSSPLVLTFLLNALWQVAFIAGLAALGSWLLRNSVARYRHWL
Ga0070670_10005114513300005331Switchgrass RhizosphereMRTSSQLLLTFLLNACWQIALIAAFASAGSWLLRNSLARYRH
Ga0070677_1041875613300005333Miscanthus RhizosphereMRLSSQLLLTFLFNAFWQIALMVVLASLGSWLLRNSLARHRHWVWAT
Ga0070682_10180957513300005337Corn RhizosphereMKISSQILLTFLLNACWQVAFVAALASVSSWLFRNSAARYRHWIWVAA
Ga0070689_10130156813300005340Switchgrass RhizosphereMKLSSQLLLTFLFNAFWQIALIAAFASLSSWLLRNSFARY
Ga0070691_1066687713300005341Corn, Switchgrass And Miscanthus RhizosphereMRISSQLLLNFLLNAAWQIALIAALASLGGWLLRSSASRYRHWVWVSA
Ga0070692_1031376633300005345Corn, Switchgrass And Miscanthus RhizosphereMRTISQLLLTFLLNSVWQIALIASLASISAWLLRNSAARYRHW
Ga0070692_1054911513300005345Corn, Switchgrass And Miscanthus RhizosphereMRTSSQLLLNFLLNAAWQIALIAALASAGAWLLRSSAARYRHWLWV
Ga0070688_10181950523300005365Switchgrass RhizosphereMRTSSQLLLTFLLNAVWQIALIVALASFGAWLLRHSATRFQHWLWVAALCLSLL
Ga0070701_1128192823300005438Corn, Switchgrass And Miscanthus RhizosphereMRISSQLLLNFLLNAAWQIALIAALASLGAWLLRSSASRYRHW
Ga0070681_1029809163300005458Corn RhizosphereMKLSSPLVLTFLLNAVWQVALIAGLAAPGSWLLRNSVARYHHWLWSSALCLAFF
Ga0070699_10182113113300005518Corn, Switchgrass And Miscanthus RhizosphereMTIISQLLLTFLVTACWQIALIASAAALCARLFRLTTARYRHLIW
Ga0070672_10141307113300005543Miscanthus RhizosphereMRISSQLLLTFLLNAIWQVALIAALAALGSWLLRNSVARYRHW
Ga0070704_10014473943300005549Corn, Switchgrass And Miscanthus RhizosphereMTIISQLLLTFLVNACWQIALIASAAALCARLFRLTTARYRHLIWVAALT
Ga0070704_10173161623300005549Corn, Switchgrass And Miscanthus RhizosphereMRISSQLLLNFLLNAAWQIALIAALASLGAWLLRSSTSRYRHWVWVSALCL
Ga0066707_1049346013300005556SoilMRTISQVLLTFLLNACWQIALVTAVASLCAWLLRRTAARYRHF
Ga0068854_10204844823300005578Corn RhizosphereMRISSQLLLNFLLNAAWQIALIAALASLGAWLLRSSASRYRHWVWVSAFCLSFLL
Ga0068859_10305317413300005617Switchgrass RhizosphereMKISSQVLLNFLLNSFWQIALVAVLASVASWLLRNSAARY
Ga0068864_10077123613300005618Switchgrass RhizosphereMKISSQILLTFLLNACWQVAFVAALASVSSWLFRNSAARYR
Ga0068863_10100797733300005841Switchgrass RhizosphereMNSQLLLTFLLNACWQITLIAALASLGSWLLRNSVVRYQHWVWVSALCLA
Ga0068863_10215996813300005841Switchgrass RhizosphereMRLSSQLLLTFLLNACWQVALIAALASLGSWLLRNSTAR
Ga0068863_10274670213300005841Switchgrass RhizosphereMRTSSQLLLTFLLNAVWQIALVAALASFGAWLLRRSAMRYQHWLWVAALCL
Ga0068860_10169566823300005843Switchgrass RhizosphereMRISSPLVLTFLLNAFWQVALIAGLAALGSWLLRNSVARYRHWLWAS
Ga0081539_1005278813300005985Tabebuia Heterophylla RhizosphereMRTSSQLLLTFLLNAVWQIALIAALASFGAWLLRETATRYQHW
Ga0079222_1051935333300006755Agricultural SoilMRSSQLLLTFLLNAVWQVALIAGLAALGSWLLRNSVERYRH
Ga0079220_1198983813300006806Agricultural SoilMNSQLLLTFLLNACWQIALIAALASVSSWLLRNSGARYQHWLWVSALS
Ga0075428_10020761413300006844Populus RhizosphereMKISSQLLLNFLLNAVWQIALVAALASLGAWVLRSSSARYR
Ga0075421_10215575013300006845Populus RhizosphereMRTISQLLLTFLLNACWQIALITAVAVSCAWLLRGTTARYQHLLWVIAL
Ga0079215_1135772323300006894Agricultural SoilMTASSQFVLTFLLNAVWQIALIAALASFGAWVLRHSTRYQHW
Ga0075424_10218864823300006904Populus RhizosphereMRNSNQLLLTFLLNACWQIALVAALASFSSWLLRNSA
Ga0079218_1277173113300007004Agricultural SoilMKTPTQLLLTFLLNAAWQIAAVTAFAAVGAWLLRGT
Ga0105240_1146313313300009093Corn RhizosphereMRTISQLLLTFLLNSVWQIVLIASLASISAWLLRNSA
Ga0111539_1195984513300009094Populus RhizosphereMRISSQLLLTFLLNACWQIALIALLASFASWLLRTSSPRYQHWL
Ga0105245_1208990323300009098Miscanthus RhizosphereMRISSQLLLTFLLNAVWQVALIAGLAACGSWLLRNSVARYR
Ga0114129_1074188313300009147Populus RhizosphereMSELSQLLLTFLLNACWQIALVATAAALCGWLLRGTA
Ga0114129_1148848833300009147Populus RhizosphereMRTISQLLLSVLLNACWQIALISLFVALCSWLLRSAAARYR
Ga0126304_1100844113300010037Serpentine SoilMKISSQIVLTFLLNACWQIALVAALAASASWLLRNCAS
Ga0126309_1129981113300010039Serpentine SoilMRLSSQLLLTFLLNACWQVSLIAAFASLGSWLLRNSS
Ga0126308_1095746713300010040Serpentine SoilMRISSQLLLTFLLNAVWQVALIAALASFGSWLLRNSGARYRHWLWVGGL
Ga0126312_1113379423300010041Serpentine SoilMKISSQLLLNFLLNATWQIALIGTLARLGAWLLQWFSARYR
Ga0126314_1002437513300010042Serpentine SoilMRISSQLLLTFLLNACWQIALIAALASSGSWLLRNSVARYRHWVW
Ga0126380_1107137913300010043Tropical Forest SoilMRAISQLLLTFLLNACWQIALITLAAALCAWLLRGTAARYRHLLGVIALVSSF
Ga0126380_1198682123300010043Tropical Forest SoilMRTISQLLLTFLLNACWQIALITAVAALCAWLLRGTTARY
Ga0126370_1232220323300010358Tropical Forest SoilMTTSSQLLLTFLLNACWQIALMAALAACSSWLLRNSVARYRHWVWVS
Ga0126372_1169849013300010360Tropical Forest SoilMRISSQLLLTFLLNAFWQVALIAGLAALGSWLLRYSVARY
Ga0126377_1167128213300010362Tropical Forest SoilMRTISQLLLTFLLNACWQIALITTVAALCGRLLRGTTARY
Ga0126377_1351682713300010362Tropical Forest SoilMSSQLLLTFLFNAAWQIALIAGLASFGSWLLRNSVVRYRHWVWVAAL
Ga0134128_1087782433300010373Terrestrial SoilMRLSSQLLLTFLLNACWQIALMAALASLGSWLLRNSFARYRHW
Ga0134127_1122918733300010399Terrestrial SoilMRISSQLLLTFLLNACWQIALIAALAALGSWLLRNSLARYQHRFWVTALC
Ga0134127_1271486523300010399Terrestrial SoilMNSQLLLTFLLNACWQIALIAALAALGSWLLRNSVVRYQHWVWVSALCL
Ga0134122_1246683513300010400Terrestrial SoilMNSQLLLTFLLNACWQIALIAALASAGSWLLRNSVARYQHWVWVSAL
Ga0134121_1193400123300010401Terrestrial SoilMRTSSELLLTFLLNAVWQIALIAALASFGAWLLRRSA
Ga0137360_1113193923300012361Vadose Zone SoilMRTLSQLLLTFLLNACWQIPLIAALASFCGWLLRRS
Ga0150984_11012926413300012469Avena Fatua RhizosphereMRLSSQLLLTFLLNACWQILLITSFASLGSWLLRHSFARYRHLVW
Ga0157373_1146464313300013100Corn RhizosphereMRLSSQLLLTFLLNACWQVALIAALASLGSWLLRN
Ga0157371_1116335423300013102Corn RhizosphereMRISSQLLLTFLLNSLWQIALITAVAALGSWLLRNFTAR
Ga0157371_1150230323300013102Corn RhizosphereMKLSSQLLLTFLFNAFWQIALIAAFASLSSWLLRNSFARYRHWVWAAALCL
Ga0163162_1214349613300013306Switchgrass RhizosphereMRISSQLLLNFLLNAAWQIALIAALASLGAWLLRSSTSRYRHWVWVSA
Ga0163162_1234654013300013306Switchgrass RhizosphereMRTISQLLLTFLLNSIWQIALIAGLAALGSWLLRDAVARY
Ga0157375_1161182333300013308Miscanthus RhizosphereMNSQLLLTFLLNACWQIALIALLASFASWLLRTSSPRY
Ga0120183_101998523300013754TerrestrialMRIASQLLLTFLLNSLWQIALIAALATFGAWLLRNSAVRYRHWVWVGAL
Ga0173480_1085835523300015200SoilMRLSSQLLLTFLFNAFWQIALIAAFASLSSWLLRNSFARYRHWVQAAALCLAFLV
Ga0137418_1021498313300015241Vadose Zone SoilMKLISQLLLTFLLNACWQIAFIAAAVALCAWLLRTATKRYQHLLWVSA
Ga0132257_10034537343300015373Arabidopsis RhizosphereMRNSNQLLLTFLLNACWQIALVAALASFSSWLLRNSAARY
Ga0132255_10029549913300015374Arabidopsis RhizosphereMRAISQLLLTFLLNSVWQIALIASLASISAWLLRNSAARYLHWIWVA
Ga0132255_10616804813300015374Arabidopsis RhizosphereMRISSQLLLTFLLNACWQIALIAALAAIGSRLLRKSAARYHHWLWVSALCL
Ga0190274_1129734833300018476SoilMKISSQLILTFLLNACWQVAVVAALASSASWLFRNSPARYR
Ga0173479_1075950313300019362SoilMRISSQLLLTFLLNACWQIALIAALAALGSRWLRKSAARYHH
Ga0126371_1345142513300021560Tropical Forest SoilMKTISYLLLTFLLNSVWQIALVVAFAAAGAWVLRNIGGPHRHL
Ga0207656_1054939413300025321Corn RhizosphereMNSQLLLTFLLNACWQIALIAVLASFASWLLRNSEARYQHWLW
Ga0207647_1025261933300025904Corn RhizosphereMRISSQLLLTFLLNSLWQIALITAVAALGSWLLRNFTARYQHWLWVSAFC
Ga0207649_1090049933300025920Corn RhizosphereMRTSSQLLLNFLLNAAWQIALIAALASAGAWLLRSSAARYRHWLWVGAFCLAFL
Ga0207646_1053047813300025922Corn, Switchgrass And Miscanthus RhizosphereMTTISQLLLTFLLNACWQVALVALAALLCARLLRTTTARY
Ga0207659_1179169823300025926Miscanthus RhizosphereMKISSQLLLNFLLNAVWQIAFITALASLGAWLLKSWSARYRHWLWVSALCLS
Ga0207704_1098080023300025938Miscanthus RhizosphereMTISSQLLLTFLLNAIWQVALIAALAALGSWLLRNSVAR
Ga0207704_1110816713300025938Miscanthus RhizosphereMTPISQMLLTFLLNACWQIVIVVLIAAACDRLLRR
Ga0207711_1091337723300025941Switchgrass RhizosphereMRNSNQLLLTFLLNACWQIALVAALASFSSWLLRNSAARYRHWIWVAA
Ga0207703_1155078113300026035Switchgrass RhizosphereMKLSSQLLLTFLLNACWQILVITSFASIGSWLLRNSFARYRHL
Ga0207639_1200514413300026041Corn RhizosphereMRTGSQLLLTFLLNAVWQIALIAVLASFGAWLLRR
Ga0207641_1065172113300026088Switchgrass RhizosphereMRLSSQLLLTFLFNAFWQIALITSVASLGSWLLRN
Ga0207641_1220393923300026088Switchgrass RhizosphereMRLSSQLLLTFLLNACWQVALIAALASLGSWLLRNSTARYRHW
Ga0207648_1088408113300026089Miscanthus RhizosphereMRTISQLLLTFLLNSLWQIALVAGLAVLGSWLLRDSVARY
Ga0207675_10192485623300026118Switchgrass RhizosphereMRLSSQLLLTFLLNALWQIALIALVASLGTWLLRNSFARYRHWVWATAL
Ga0209074_1051548213300027787Agricultural SoilMRSSQLLLTFLLNAVWQVALIAGLAALGSWLLRNSVERYRHW
Ga0207428_1116765513300027907Populus RhizosphereMRTISQLLLTFLLNACWQIALVTAVAALCARLLRWASARYQ
Ga0209526_1018127613300028047Forest SoilMRVSSQLLLTFLLNACWQVAFLAAAVSLCARLLRDSGRGFQ
Ga0247682_101156243300028146SoilMERISQALLTCLLNACWQIALITSVAALCAWLLRETAAR
Ga0268240_1013852623300030496SoilMRLSSQLLLTFLLNALWQIALIALVASLGSWLLRNSFARY
Ga0307505_1032089813300031455SoilMRTVSQLLLNFLLNAAWQIALIAALAGLGAWLLRSSSARYRHWLWVGALCLAFL
Ga0307408_10068349313300031548RhizosphereMKISSQLLLNFLLNAVWQIALVTALASLGAWLLRSSSARYRHWIWVSALCL
Ga0307407_1009909343300031903RhizosphereMRMSSQMLLTFLLNAIWQVALIAALAALGAWLLRNSGARYRHWV
Ga0307407_1162098813300031903RhizosphereMRISSQLLLTFLLNACWQVALIAALAGIGAMLLRN
Ga0307479_1074663223300031962Hardwood Forest SoilMKTISQLLLTVLLNAVWQVAVVAALAWVCDRLLRPLHARYRHILWVAALA
Ga0310902_1110827323300032012SoilMITSSQLLPTFLLNAVWQIALIAALASFGAWLLRQSGTRYQHWLWVAALCLSL
Ga0307415_10053588613300032126RhizosphereMRISSQLLLTFLLNAVWQIALIAALASVGAWLLRKSTMRYQHWA
Ga0307471_10394243513300032180Hardwood Forest SoilMSSQLLLTFLLNACWQIALIAALASLGSWLLRNSVARYQHWVW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.