NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095570

Metagenome / Metatranscriptome Family F095570

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095570
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 60 residues
Representative Sequence TEYLYDRENPKSHMRQRLTGIEGFMYGNPNMNERADMIGRALAKETDGDFTKFVLRT
Number of Associated Samples 91
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.90 %
% of genes near scaffold ends (potentially truncated) 83.81 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(51.429 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(63.810 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.35%    β-sheet: 0.00%    Coil/Unstructured: 57.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002037|BIB12012_10139174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea767Open in IMG/M
3300004794|Ga0007751_10855771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea682Open in IMG/M
3300004795|Ga0007756_11561584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea688Open in IMG/M
3300005678|Ga0074427_106851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea711Open in IMG/M
3300005686|Ga0074435_115038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea716Open in IMG/M
3300005688|Ga0074437_100637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea726Open in IMG/M
3300005689|Ga0074438_1011214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea701Open in IMG/M
3300005988|Ga0075160_10381439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea766Open in IMG/M
3300006037|Ga0075465_10100249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea642Open in IMG/M
3300006056|Ga0075163_11107957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea801Open in IMG/M
3300006056|Ga0075163_11216711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea753Open in IMG/M
3300006355|Ga0075501_1241222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea719Open in IMG/M
3300006378|Ga0075498_1346657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea666Open in IMG/M
3300006401|Ga0075506_1701664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300006417|Ga0069787_10534804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea681Open in IMG/M
3300006641|Ga0075471_10291997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea831Open in IMG/M
3300006641|Ga0075471_10330081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea773Open in IMG/M
3300006803|Ga0075467_10314419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea831Open in IMG/M
3300006875|Ga0075473_10192530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea823Open in IMG/M
3300007513|Ga0105019_1257547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea785Open in IMG/M
3300007716|Ga0102867_1089946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea816Open in IMG/M
3300009265|Ga0103873_1062060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea734Open in IMG/M
3300009402|Ga0103742_1023481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea776Open in IMG/M
3300009599|Ga0115103_1530520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea686Open in IMG/M
3300009599|Ga0115103_1682079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea707Open in IMG/M
3300009599|Ga0115103_1683601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea731Open in IMG/M
3300009606|Ga0115102_10187478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea646Open in IMG/M
3300009606|Ga0115102_10407142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea577Open in IMG/M
3300009608|Ga0115100_10828165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300009677|Ga0115104_10842118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea688Open in IMG/M
3300010307|Ga0129319_1044939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea691Open in IMG/M
3300010981|Ga0138316_10870004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300012412|Ga0138266_1197565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea769Open in IMG/M
3300012414|Ga0138264_1734726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea767Open in IMG/M
3300012416|Ga0138259_1502948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea777Open in IMG/M
3300012417|Ga0138262_1389629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea789Open in IMG/M
3300012471|Ga0129334_1085989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea543Open in IMG/M
3300012935|Ga0138257_1118224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea853Open in IMG/M
3300013282|Ga0119927_110157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea733Open in IMG/M
3300013289|Ga0119916_104778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea691Open in IMG/M
3300017783|Ga0181379_1337067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea509Open in IMG/M
3300018628|Ga0193355_1012964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea757Open in IMG/M
3300018730|Ga0192967_1034224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea845Open in IMG/M
3300018846|Ga0193253_1090135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea727Open in IMG/M
3300018968|Ga0192894_10113398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea838Open in IMG/M
3300018976|Ga0193254_10084838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Euplotes → Euplotes harpa737Open in IMG/M
3300018980|Ga0192961_10116359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea813Open in IMG/M
3300018982|Ga0192947_10128916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea844Open in IMG/M
3300018989|Ga0193030_10131573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea798Open in IMG/M
3300018997|Ga0193257_10130145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae → Euplotes → Euplotes harpa780Open in IMG/M
3300019017|Ga0193569_10237455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea788Open in IMG/M
3300019022|Ga0192951_10178760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea766Open in IMG/M
3300019032|Ga0192869_10215748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea821Open in IMG/M
3300019048|Ga0192981_10188855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea807Open in IMG/M
3300019050|Ga0192966_10178658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea758Open in IMG/M
3300019095|Ga0188866_1020701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea691Open in IMG/M
3300019280|Ga0182068_1301363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea705Open in IMG/M
3300021169|Ga0206687_1688807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea765Open in IMG/M
3300021303|Ga0210308_1002662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea722Open in IMG/M
3300021350|Ga0206692_1352318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea761Open in IMG/M
3300021350|Ga0206692_1568773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea681Open in IMG/M
3300021350|Ga0206692_1894434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea738Open in IMG/M
3300021875|Ga0063146_127278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea715Open in IMG/M
3300021902|Ga0063086_1011951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea683Open in IMG/M
3300021925|Ga0063096_1011340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea748Open in IMG/M
3300021941|Ga0063102_1052892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea754Open in IMG/M
3300021950|Ga0063101_1087405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea666Open in IMG/M
3300021950|Ga0063101_1133687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea651Open in IMG/M
3300023709|Ga0232122_1084823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea748Open in IMG/M
3300025732|Ga0208784_1110013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea823Open in IMG/M
3300026448|Ga0247594_1043345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea769Open in IMG/M
3300026500|Ga0247592_1180872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300026513|Ga0247590_1196661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea513Open in IMG/M
3300028106|Ga0247596_1094705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea675Open in IMG/M
3300028137|Ga0256412_1194225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea750Open in IMG/M
3300028137|Ga0256412_1247046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea658Open in IMG/M
3300028137|Ga0256412_1298790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea592Open in IMG/M
3300028233|Ga0256417_1139814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea651Open in IMG/M
3300028290|Ga0247572_1139140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea606Open in IMG/M
3300028575|Ga0304731_11658835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300028647|Ga0272412_1315520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea627Open in IMG/M
3300029936|Ga0119925_107928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea671Open in IMG/M
3300030564|Ga0210256_10215999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae844Open in IMG/M
3300030601|Ga0247650_1159267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300030635|Ga0247627_10104512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea740Open in IMG/M
3300030670|Ga0307401_10270815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea770Open in IMG/M
3300030709|Ga0307400_10541990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea732Open in IMG/M
3300030709|Ga0307400_10663892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea650Open in IMG/M
3300030741|Ga0265459_11153522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae839Open in IMG/M
3300030741|Ga0265459_11737300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea731Open in IMG/M
3300030741|Ga0265459_14011562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300030743|Ga0265461_11012294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Hypotrichia → Euplotida → Euplotidae824Open in IMG/M
3300030788|Ga0073964_11109079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea654Open in IMG/M
3300030923|Ga0138296_1627005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea741Open in IMG/M
3300031005|Ga0073974_1680321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea631Open in IMG/M
3300031036|Ga0073978_1488800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea689Open in IMG/M
3300031050|Ga0074028_11251874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea766Open in IMG/M
3300031469|Ga0170819_17155653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea759Open in IMG/M
3300031522|Ga0307388_10879140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea603Open in IMG/M
3300031579|Ga0308134_1083192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea729Open in IMG/M
3300031729|Ga0307391_10507086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea677Open in IMG/M
3300031729|Ga0307391_10732446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea565Open in IMG/M
3300032491|Ga0314675_10361997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea725Open in IMG/M
3300032730|Ga0314699_10304054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea717Open in IMG/M
3300032733|Ga0314714_10637760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea587Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine20.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.14%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.48%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.57%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine4.76%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.81%
Lab-Scale Ebpr BioreactorEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor3.81%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.86%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.86%
Activated SludgeEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge2.86%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.86%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.90%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.90%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.95%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.95%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.95%
Delisea PulchraHost-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra0.95%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.95%
Enhanced Biological Phosphorus Removal BioreactorEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor0.95%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.95%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002037Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_B1Host-AssociatedOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005678Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91307 Phage SequencingEngineeredOpen in IMG/M
3300005686Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V92206 Phage SequencingEngineeredOpen in IMG/M
3300005688Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V92809 Phage SequencingEngineeredOpen in IMG/M
3300005689Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V92810 Phage SequencingEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006417Combined Assembly of Gp0110018, Gp0110022, Gp0110020EngineeredOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010307Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013282Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V92809EngineeredOpen in IMG/M
3300013289Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V91210EngineeredOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021875Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023709Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028647Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300029936Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V92206EngineeredOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030601Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030635Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031050Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BIB12012_1013917413300002037Delisea PulchraMTEYLYDRDNPKSNLRQKLTGVEGMLYGVPNLNERAEMINRSLLKHTDGDITKWVQQTQKPRDEA*
Ga0007751_1085577113300004794Freshwater LakeLYDRENPKSHLRQRLTGIEGLMYGVPNINERADMIGRALAKETDGDFAKFILNTKKPRDNA*
Ga0007756_1156158413300004795Freshwater LakeEYLYDRENPKSHLRQRLTGIEGLMYGVPNINERADMIGRALAKETDGDFAKFILNTKKPRDNA*
Ga0074427_10685113300005678Lab-Scale Ebpr BioreactorIIMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*
Ga0074435_11503813300005686Lab-Scale Ebpr BioreactorLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*
Ga0074437_10063723300005688Lab-Scale Ebpr BioreactorPKTPFQFNIIIMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*
Ga0074438_101121413300005689Lab-Scale Ebpr BioreactorDSIMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*
Ga0075160_1038143923300005988Wastewater EffluentSLIIIIMTEYLYDRDNPKSPLRQRLTGIEGFFYGLPNINERAEMVNRALLRENDNDITKFVMQLKKPRDNA*
Ga0075465_1010024913300006037AqueousLFNVDIIINKMTEYLYDRENPKSHLRQRLTGIEGLFYGVPNINERADMIGRALAKETDGDFGKFV*
Ga0075163_1110795733300006056Wastewater EffluentPKPQNPKTPKPLSTLYIIIMTEYLYD*DNPKSSLRQRITGVEGFYYGLPNINERAEMVNRALLREYDNDVTKFANMLKKPRDEA*
Ga0075163_1121671113300006056Wastewater EffluentPKTPKPQNPKTPFQFNIIIMTEYLYD*ENPKSNLRQKLTGIEGFFYGLPNINERAEMVNRALLKDNDNDVTKFMMQLKKPRDNA*
Ga0075501_124122213300006355AqueousYDRENPKSHLRQRLTGIEGLMYGNPNHNERVEMIGRALAKETDGDFTKFVNKT*
Ga0075498_134665723300006378AqueousYDRENPKSHLRQRLTGIEGLFHGVPNINERADMIGRALAKETDGDFGKFVENMKKPQDEA
Ga0075506_170166423300006401AqueousYDRENPKSRLRQRITGIETIMRGTPNINERADMIGRALAKQTDGDWTKFVQNQKKP*
Ga0069787_1053480413300006417Enhanced Biological Phosphorus Removal BioreactorEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*
Ga0075471_1029199723300006641AqueousMTEYLYDRENPKSHLRQRLTGVEGFFWGNPNINERAEMVYRALAKETDGEITKFVQKTAKPRDNA*
Ga0075471_1033008123300006641AqueousMTEYLYDRENPKSHLRQRLTGIEGLMYGNPNHNERVEMIGRALAKETDGDFTKFVNKT*
Ga0075467_1031441923300006803AqueousMTEYLYDRENPKSHFRQRLTGIEGLMHGNPNMNERADMIGRALAKETDGDFTKFVAKTAKPRDMA*
Ga0075473_1019253013300006875AqueousMTEYLYDRENPKSHLRQRLTGIEGLFHGVPNINERADMIGRALAKETDGDFGKFVENMKKPQDEA*
Ga0105019_125754723300007513MarineMTEYLYDRENPKSHFRDRLTGIEGLMYGNPNMAERADMIGRALAKDTDGDFTKFVMKTGKPRDDA*
Ga0102867_108994623300007716EstuarineMTEYLYDRENPKSHFRQRLTGIEGLMYGNPNMNERADMIGRALAKETDGDFTKFVAKTAKPRDMAQK*
Ga0103873_106206013300009265Surface Ocean WaterEYLYDRENPKSRLRERITGIETIMRGVPNIHERADMIGRALAKDTDGDFTKFVTQMKKP*
Ga0103742_102348123300009402Ice Edge, Mcmurdo Sound, AntarcticaMTEYLYDRNNPKSHLRERLTGIEGFMYGNPNMHERAEMVGRSLAKEADGDISKWV*
Ga0115103_153052013300009599MarineYDRDNPKSALRQKSTGIEGFFYGVPNINERADMIGRSLAKHTDGDFTKFVDE*
Ga0115103_168207933300009599MarineEYLYDRENPKSALQTKGIGIEGFMYGNPNMMERADMIGRALAKDTDGDFTKFVQKTNKPRDEA*
Ga0115103_168360113300009599MarineEYLYDRENPKSRLRERITGIETIMRGVPNIHERADMIGRALAKDTDGDFTKFVQQMKKP*
Ga0115102_1018747813300009606MarineLYDRENPKSNFRQRLTGIEGLMYGNPNMNERADMIGRALAKETDGDYTKFVTRT*
Ga0115102_1040714213300009606MarineYDRDNPKSHFRQRTTGIEGLFFGVPNINERADMIGRALAKETDGDFAKFVNNTKKPRDNA
Ga0115100_1082816513300009608MarineDRDNPKSHFRQRTTGIEGLFFGVPNINERADMIGRALAKETDGDFAKFVNNTKKPRDNA*
Ga0115104_1084211823300009677MarineKSRLRERITGIETLMRGVPNIHERADMIGRALARDTDGDWTKFVQNTKKP*
Ga0129319_104493933300010307AqueousTEYLYDRDNAKSHLRQRLTGIEGLFYGVPNINERADMIGRALAKETDGDFGKFVLNTKKPRDNA*
Ga0138316_1087000413300010981MarineTEYLYDRENPKSHFRQRLLGIEGFFFGNPNTNERADMIGRALAKGTDGDFTKFVMKT*
Ga0138266_119756513300012412Polar MarineMTEYLYDRENPKSHLRQRLTGIEGLFYGVPNINERADMIGRALAKETDGEFSKFVD*
Ga0138264_173472613300012414Polar MarineTEYLYDRENPKSHLRQRLTGIEGLFYGVPNINERADMIGRALAKETDGEFSKFVD*
Ga0138259_150294823300012416Polar MarineNMTEYLYDRENPKSHLRQRLTGIEGLFYGVPNINERADMIGRALAKETDGEFSKFVD*
Ga0138262_138962923300012417Polar MarineSNMTEYLYDRENPKSHLRQRLTGIEGLFYGVPNINERADMIGRALAKETDGEFSKFVD*
Ga0129334_108598913300012471AqueousDRDNPKSAFHQRTTGIEGLFYGLPNMNERADMIARALVRETDGDFTKFV*
Ga0138257_111822423300012935Polar MarineLGYLYDRENPKSHLRQRLTGIEGLFYGVPNINERADMIGRALAKETDGEFSKFVD*
Ga0119927_11015713300013282Activated SludgePQNPKTPFQFNIIIMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*
Ga0119916_10477823300013289Activated SludgeIMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*
Ga0181379_133706713300017783SeawaterKMTEYLYDRENPKSHFRQRLMGIEGMMYGLPNMNERAEMIGRALAKETDGDFTKFVMKTQKPRDEA
Ga0193355_101296413300018628MarineHGDNIKMTEYLYDRSNPKSALQTRGSGIEGFMYGTPNLNERADMIGRALSKETDGDFSKFVARTNKPRDDA
Ga0192967_103422413300018730MarineTWGLINLIKKMTEYLYDRNNPKSHLRERLTGIEGFMYGNPNMHERAEMVGRSLAKEADGDISKWV
Ga0193253_109013513300018846MarineTEYLYDRENPKSRLRERITGIETIMRGVPNIHERADMIGRALAKDTDGDFTKFVQQMKKP
Ga0192894_1011339823300018968MarineMTEYLYDRENPKSNFRQRLTGIEGFMYGNPNMNERADMIGRALAKETDGDFTKFVMRTAKPRDMA
Ga0193254_1008483833300018976MarineSTEYLYDRDNPKSALRQRGTGIEGFMYGVPNINERADMIGRALAKQTDGDFTKFVDDLNKPRDNA
Ga0192961_1011635913300018980MarineMTEYLYDRENPKSKLRQRITGIETLMRGVPNINERADMVARSLAKETDGDWAKFVQNQKK
Ga0192947_1012891613300018982MarineMTEYLYDRENPKSHFRQRLTGIEGLMYGNPNMNERADMIGRALAKETDGDFTKFVARTQKPRDMA
Ga0193030_1013157313300018989MarineMTEYLYDRENPKSNFRQRLTGIEGLMYGNPNMNERAVMIHRALHKQCDGDYQKFVNTMAKPRDMA
Ga0193257_1013014513300018997MarineIKMSTEYLYDRDNPKSALRQRGTGIEGFMYGVPNINERADMIGRALAKQTDGDFTKFVDDLNKPRDNA
Ga0193569_1023745513300019017MarineTEYLYDRDNPKSVMRQRLTGIEGFMYGVPNINERADMIGRALAKDTDGDFFKFVNNAKKPRDNA
Ga0192951_1017876023300019022MarineMTEYLYDRNNPKSHLRERLTGIEGFMYGNPNMHERAEMVGRSLAKEADGDISKWV
Ga0192869_1021574823300019032MarineHGNLYLIINMTEYLYDRDCPKSNFRQRLTGIEGLMYGNPNMNERTDMIARALCKETDGDL
Ga0192981_1018885523300019048MarineMTEYLYDRENPKSHLRQRLTGIEGFMHGNPNMNERADMIGRALAKDTDGDYTKFVLRT
Ga0192966_1017865813300019050MarineTWGLLINLIKKMTEYLYDRNNPKSHLRERLTGIEGFMYGNPNMHERAEMVGRSLAKEADGDISKWV
Ga0188866_102070123300019095Freshwater LakeENPKSNFRQRLTGIEGFFYGNPNMMERADMIGRALAKETDGDFGKMVGKT
Ga0182068_130136323300019280Salt MarshTEYLYDRENPKSRLRERITGIETIMRGVPNIHERADMIGRALAKDTDGDFTKFVTQMKKP
Ga0206687_168880713300021169SeawaterEYLYDRENPKSKLRQQITGIETMLRGVPNINERADMIGRALAKETDGDWTKFVQA
Ga0210308_100266233300021303EstuarineTEYLYDRENPKSHLRQRLTGIEGLFHGVPNINERADMIGRALAKETDGDFTKFV
Ga0206692_135231823300021350SeawaterYLYDRENPKSKLRQQITGIETMLRGVPNINERADMIGRALAKETDGDWTKFVQA
Ga0206692_156877323300021350SeawaterMTEYLYDREHPKSNFRQRLTGIEGLMWGNPNMNERADMIGRALAKETDGDFTKFVTKT
Ga0206692_189443413300021350SeawaterMTEYLYDRENPKSRLRERITGIETIMRGVPNIHERADMIGRALAKDTDGDFTKFVQQMKK
Ga0063146_12727813300021875MarineTEYLYDRENPKSNFRQRLTGIEGFFYGNPNMMERADMIGRALAKETDGDFGKMVGKT
Ga0063086_101195113300021902MarineMTEYLYDRENPKSHMRQRLTGMEGFMYGNPNMNERADMIGRALAKETDGDFSKFVLRT
Ga0063096_101134013300021925MarineXKMTEYLYDRENPKSHLRQRMTGIEGFMFGNPNMNERADMIGRALAKETDGDFTKFVLRTAKPRDMA
Ga0063102_105289213300021941MarineTEYLYDRENPKSHMRQRLTGMEGFMYGNPNMNERADMIGRALAKETDGDFSKFVLRT
Ga0063101_108740513300021950MarineEYLYDRENPKSHMRQRLTGMEGFMYGNPNMNERADMIGRALAKETDGDFSKFVLRT
Ga0063101_113368713300021950MarineLYDRNNPKSHLRERLTGIEGFMYGNPNMYERADMIGRSLAKEADGDISKWV
Ga0232122_108482313300023709Salt MarshEYLYDRENPKSHFRQRLTGIEGLYYGVPNINERADMIGRALAKQTDGDFAKFV
Ga0208784_111001323300025732AqueousMTEYLYDRENPKSHLRQRLTGIEGLFHGVPNINERADMIGRALAKETDGDFGKFVENMKKPQDEA
Ga0247594_104334523300026448SeawaterFEYKMTEYLYDRENPKSHMRQRLTGIEGFMYGNPNMNERADMIGRALAKETDGDFTKFVLRT
Ga0247592_118087213300026500SeawaterYLYDRENPKSNFRQRLTGIEGFFYGNPNMNERADMIGRALAKETDGDFTKFVLRT
Ga0247590_119666113300026513SeawaterYLYDRENPKSNFRQRLTGIEGLMYGNPNMNERADMIGRALAKETDGDYTKFVTRT
Ga0247596_109470523300028106SeawaterTEYLYDRENPKSHMRQRLTGIEGFMYGNPNMNERADMIGRALAKETDGDFTKFVLRT
Ga0256412_119422513300028137SeawaterLYDRENPKSHMRQRLTGIEGFMYGNPNMNERADMIGRALAKETDGDFTKFVLRT
Ga0256412_124704613300028137SeawaterYLYDRDNPKSRLRERITGIETIMRGVPNIHERADMIGRALAKDTDGDFTKFVQQMKKP
Ga0256412_129879013300028137SeawaterMTEYLYDRENPKSHMRQRLTGIEGFMYGNPNMNERADMIGRALAKETDGDFTKFVLRT
Ga0256417_113981413300028233SeawaterNPKSHFRQRLMGIEGMMYGLPNMNERAEMIGRALAKETDGDFTKFVMKT
Ga0247572_113914013300028290SeawaterYKMTEYLYDRENPKSHMRQRLTGIEGFMYGNPNMNERADMIGRALAKETDGDFTKFVLRTQKPRDMA
Ga0304731_1165883513300028575MarineTEYLYDRENPKSHFRQRLLGIEGFFFGNPNTNERADMIGRALAKGTDGDFTKFVMKT
Ga0272412_131552023300028647Activated SludgeEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA
Ga0119925_10792813300029936Activated SludgeLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDN
Ga0210256_1021599913300030564SoilITIKMTEYLYDRDNPKSHFRQRISGIQGLFYGVPNINERADMIGRALAKETDGDFGKFVTTTRKPRDMA
Ga0247650_115926713300030601SoilTEYLYDRDNPKSHFRQRITGIQSLFYGVPNINERVDMIGRALAKDTDGDFGKFVFTTRKPRDMA
Ga0247627_1010451213300030635SoilEYLYDRDNPKSHFRQRITGIEGLFYGVPNINERADMIGRSLAKLTDGDFGKFVNTTRKPRDTA
Ga0307401_1027081513300030670MarineKKMTEYLYDRNNPKSHLRERLTGIEGFMYGNPNMHERAEMVGRSLAKEADGDISKWV
Ga0307400_1054199033300030709MarineTEYLYDRENPKSHLRQRLTGIEGFMHGNPNMNERADMIGRALAKDTDGDYTKFVLRT
Ga0307400_1066389213300030709MarineLIKKMTEYLYDRNNPKSHLRERQTGIEGFMYGNPNMHERAEMVGRSLAKEADGDISKWV
Ga0265459_1115352213300030741SoilEIITIKMTEYLYDRDNPKSHFRQRISGIQGLFYGVPNINERADMIGRALAKETDGDFGKFVTTTRKPRDMA
Ga0265459_1173730013300030741SoilTEYLYDRDNPKSHFRQRISGIQGLFYGVPNINERADMIGRSLAKETDGDFGKFILSTRKPRDNA
Ga0265459_1401156213300030741SoilKSHFRQRISGIQSLFYGVPNINERADMISRSLAKETDGDFGKFVASTRKPRDNA
Ga0265461_1101229423300030743SoilTEYLYDRDNPKSHFRQRISGIQGLFYGVPNINERADMIGRALAKETDGDFGKFVTTTRKPRDMA
Ga0073964_1110907923300030788MarineYDRSNPKSGLQTRGSGIEGFMYGTPNLNERADMIGRALAKETDGDFAKFVNKTGKPRDEA
Ga0138296_162700513300030923SoilEYLYDRDNPKSHFRQRISGIQGLFYGVPNINERADMIGRSLAKETDGDFAKFVQTTRKPRDMA
Ga0073974_168032123300031005MarineEYLYDRENPKSRLRERITGIETIMRGVPNIHERADMIGRALAKDTDGDFTKFVANMKKP
Ga0073978_148880013300031036MarineMTEYLYDRENPKSRLRERITGIETIMRGVPNIHERADMIGRALAKDTDGDFTKFVANMKK
Ga0074028_1125187413300031050SoilEYLYDRDNPKSHFRQRISGIQGLFYGVPNINERADMIGRALAKETDGDFTKFVMATRKPRDYA
Ga0170819_1715565313300031469Forest SoilPKSHFRQRITGIQSLFYGVPNINERADMICRALAKETDGDLGKFVNTLKKPRDMA
Ga0307388_1087914013300031522MarineKMTEYLYDRNNPKSHLRERLTGIEGFMYGNPNMHERAEMVGRSLAKEADGDISKWV
Ga0308134_108319213300031579MarineLYDRENPKSHLRQRMTGIEGFMFGNPNMNERADMIGRALAKETDGDFTKFVLRTAKPRDM
Ga0307391_1050708613300031729MarineKMTEYLYDRNNPKSHLRERQTGIEGFMYGNPNMHERAEMVGRSLAKEADGDISKWV
Ga0307391_1073244613300031729MarineDRENPKSKLRQRITGIETLMRGVPNINERADMVARSLAKETDGDWAKFVQNQKKP
Ga0314675_1036199723300032491SeawaterYDRENPKSKLRQQITGIETMLRGVPNINERADMIGRALAKETDGDWTKFVQA
Ga0314699_1030405413300032730SeawaterNMTEYLYDRENPKSNFRQRLTGIEGFFYGNPNMMERADMIGRALAKETDGDFGKMVGKT
Ga0314714_1063776023300032733SeawaterEYLYDRENPKSALRTRGTGIEGFFYGNPNMMERAEMVGRALAKDADGDFGKFV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.