Sample 3300013282

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300013282

3300013282: Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V92809

Overview

Basic Information
IMG/M Taxon OID	3300013282 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118585 \| Gp0137270 \| Ga0119927
Sample Name	Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V92809
Sequencing Status	Permanent Draft
Sequencing Center	California Institute of Technology
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	45829823
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia
Type	Engineered
Taxonomy	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Australia: Queensland
Coordinates	Lat. (^o)	-27.49999	Long. (^o)	153.01209	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095570	Metagenome / Metatranscriptome	105	Y
F100051	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0119927_108576	All Organisms → cellular organisms → Bacteria	798	Open in IMG/M
Ga0119927_110157	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea	733	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0119927_108576	Ga0119927_1085763	F100051	VFGHRYVVERVLNHGARKVGCTRCGKHWGMHDVTRSFVPWDGELEALYAPGGILAQASGDVPPNAKVSGAGTASAGLPG*
Ga0119927_110157	Ga0119927_1101571	F095570	PQNPKTPFQFNIIIMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.