NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F096818

Metagenome Family F096818

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096818
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 46 residues
Representative Sequence RAAANRTTYPTGWPPFGATEPRTWGPSRMIYWAKIGFEKWWLWRYF
Number of Associated Samples 94
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 84.62 %
% of genes from short scaffolds (< 2000 bps) 83.65 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(9.615 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(29.808 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.32%    β-sheet: 0.00%    Coil/Unstructured: 75.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF07992Pyr_redox_2 6.73
PF09976TPR_21 5.77
PF13432TPR_16 4.81
PF00890FAD_binding_2 3.85
PF02190LON_substr_bdg 3.85
PF00701DHDPS 3.85
PF02577BFN_dom 3.85
PF13174TPR_6 2.88
PF03401TctC 1.92
PF04199Cyclase 1.92
PF04055Radical_SAM 1.92
PF02597ThiS 1.92
PF07728AAA_5 0.96
PF04273BLH_phosphatase 0.96
PF13429TPR_15 0.96
PF028262-Hacid_dh_C 0.96
PF02780Transketolase_C 0.96
PF01807zf-CHC2 0.96
PF13175AAA_15 0.96
PF06577EipA 0.96
PF13428TPR_14 0.96
PF00753Lactamase_B 0.96
PF13676TIR_2 0.96
PF01977UbiD 0.96
PF03928HbpS-like 0.96
PF07366SnoaL 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 7.69
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 3.85
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 1.92
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 1.92
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 1.92
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.92
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.96
COG0358DNA primase (bacterial type)Replication, recombination and repair [L] 0.96
COG3453Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 familyGeneral function prediction only [R] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.50 %
UnclassifiedrootN/A37.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2084038009|LWFCA_GLZZ6Z001BAB4DAll Organisms → cellular organisms → Bacteria510Open in IMG/M
2088090009|LWAnN_GIDYKCY01BMO3SAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300000205|NICFPass4XylDRAFT_c026922Not Available772Open in IMG/M
3300000891|JGI10214J12806_12946728All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300000956|JGI10216J12902_122123046Not Available541Open in IMG/M
3300001781|Deep_1051506All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300001840|shallow_1071031All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300002121|C687J26615_10097969Not Available735Open in IMG/M
3300002124|C687J26631_10047387All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300002147|JGI24793J26633_1026591Not Available1229Open in IMG/M
3300002529|C687J35504_10088301All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_55_131398Open in IMG/M
3300002558|JGI25385J37094_10193139All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300002561|JGI25384J37096_10181105All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300002908|JGI25382J43887_10134469All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1273Open in IMG/M
3300003319|soilL2_10184924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3937Open in IMG/M
3300003702|PicMicro_10002430All Organisms → cellular organisms → Bacteria22514Open in IMG/M
3300004480|Ga0062592_101264269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium694Open in IMG/M
3300004779|Ga0062380_10258162All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300004782|Ga0062382_10245012All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300005093|Ga0062594_101129763All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium769Open in IMG/M
3300005180|Ga0066685_11073074Not Available528Open in IMG/M
3300005339|Ga0070660_100047813All Organisms → cellular organisms → Bacteria → Proteobacteria3284Open in IMG/M
3300005366|Ga0070659_102102519Not Available507Open in IMG/M
3300005529|Ga0070741_10000016All Organisms → cellular organisms → Bacteria625103Open in IMG/M
3300005713|Ga0066905_101437881Not Available625Open in IMG/M
3300005764|Ga0066903_104961320Not Available706Open in IMG/M
3300005830|Ga0074473_11183804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1000Open in IMG/M
3300006031|Ga0066651_10342471Not Available802Open in IMG/M
3300006845|Ga0075421_100035343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6327Open in IMG/M
3300006847|Ga0075431_100139878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2495Open in IMG/M
3300006852|Ga0075433_10265361All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1522Open in IMG/M
3300006854|Ga0075425_100559727All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300006865|Ga0073934_10000656All Organisms → cellular organisms → Bacteria96312Open in IMG/M
3300009087|Ga0105107_11026277All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300009157|Ga0105092_10493982Not Available701Open in IMG/M
3300009157|Ga0105092_10732128Not Available577Open in IMG/M
3300009162|Ga0075423_10173359Not Available2265Open in IMG/M
3300009162|Ga0075423_10313698All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1644Open in IMG/M
3300009162|Ga0075423_10605904All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300009444|Ga0114945_10074917All Organisms → cellular organisms → Bacteria1874Open in IMG/M
3300009514|Ga0129284_10209133All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300009609|Ga0105347_1309347All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium665Open in IMG/M
3300009786|Ga0114999_10837112Not Available677Open in IMG/M
3300010323|Ga0134086_10173170Not Available796Open in IMG/M
3300010359|Ga0126376_12206468Not Available596Open in IMG/M
3300010360|Ga0126372_10950267All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300010361|Ga0126378_11200131All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium857Open in IMG/M
3300010361|Ga0126378_12318149Not Available613Open in IMG/M
3300010362|Ga0126377_10635076Not Available1115Open in IMG/M
3300010366|Ga0126379_11991514Not Available683Open in IMG/M
3300010376|Ga0126381_102386018Not Available759Open in IMG/M
3300010376|Ga0126381_104111134Not Available565Open in IMG/M
3300010397|Ga0134124_12945048Not Available520Open in IMG/M
3300010398|Ga0126383_10104770All Organisms → cellular organisms → Bacteria2537Open in IMG/M
3300010401|Ga0134121_11135395Not Available777Open in IMG/M
3300012179|Ga0137334_1040321All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium971Open in IMG/M
3300012179|Ga0137334_1060792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria816Open in IMG/M
3300012356|Ga0137371_10840822Not Available699Open in IMG/M
3300012361|Ga0137360_10568918All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium969Open in IMG/M
3300012971|Ga0126369_13225648Not Available534Open in IMG/M
3300013296|Ga0157374_12245279Not Available573Open in IMG/M
3300013306|Ga0163162_13065776Not Available537Open in IMG/M
3300014745|Ga0157377_10093328All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1781Open in IMG/M
3300015372|Ga0132256_101620605Not Available757Open in IMG/M
3300015372|Ga0132256_102427028Not Available627Open in IMG/M
3300015372|Ga0132256_103470934Not Available530Open in IMG/M
3300015373|Ga0132257_100978616Not Available1064Open in IMG/M
3300018031|Ga0184634_10489442Not Available550Open in IMG/M
3300018031|Ga0184634_10510438Not Available536Open in IMG/M
3300018063|Ga0184637_10255142All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300018067|Ga0184611_1073915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1162Open in IMG/M
3300018075|Ga0184632_10300052All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300018077|Ga0184633_10187574All Organisms → cellular organisms → Bacteria → Proteobacteria1070Open in IMG/M
3300018079|Ga0184627_10503784All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018082|Ga0184639_10538989Not Available582Open in IMG/M
3300018481|Ga0190271_10879520All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300020022|Ga0193733_1104530All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium789Open in IMG/M
3300025160|Ga0209109_10120491All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_191340Open in IMG/M
3300025167|Ga0209642_10158286All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1310Open in IMG/M
3300025310|Ga0209172_10000953All Organisms → cellular organisms → Bacteria70096Open in IMG/M
3300025311|Ga0209343_10127391All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2057Open in IMG/M
3300025322|Ga0209641_11120375All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300025326|Ga0209342_10098449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2702Open in IMG/M
3300025903|Ga0207680_10915333Not Available628Open in IMG/M
3300025910|Ga0207684_11369079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium580Open in IMG/M
3300025920|Ga0207649_11579550Not Available519Open in IMG/M
3300025932|Ga0207690_10346738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1173Open in IMG/M
3300026297|Ga0209237_1256972Not Available536Open in IMG/M
3300026334|Ga0209377_1001891All Organisms → cellular organisms → Bacteria13804Open in IMG/M
3300027682|Ga0209971_1020853All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1559Open in IMG/M
3300027831|Ga0209797_10148658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1008Open in IMG/M
3300027909|Ga0209382_10053586All Organisms → cellular organisms → Bacteria4800Open in IMG/M
3300027909|Ga0209382_11062201All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium839Open in IMG/M
3300027951|Ga0209754_1006420All Organisms → cellular organisms → Bacteria → Proteobacteria6096Open in IMG/M
3300030606|Ga0299906_11081883All Organisms → cellular organisms → Bacteria583Open in IMG/M
(restricted) 3300031197|Ga0255310_10062665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium978Open in IMG/M
3300031965|Ga0326597_10613029Not Available1162Open in IMG/M
3300032003|Ga0310897_10644680Not Available527Open in IMG/M
3300032163|Ga0315281_12135184All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300032261|Ga0306920_100180372All Organisms → cellular organisms → Bacteria3150Open in IMG/M
3300032278|Ga0310345_10607371All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300033412|Ga0310810_10185886All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2368Open in IMG/M
3300033414|Ga0316619_11365770Not Available631Open in IMG/M
3300034820|Ga0373959_0095324All Organisms → cellular organisms → Bacteria702Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.88%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.88%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment1.92%
Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume1.92%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
Host-AssociatedHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.96%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.96%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.96%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.96%
Marine, Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume0.96%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.96%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.96%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.96%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%
Feedstock Adapted CompostEngineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2084038009Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - from flow sorted aerobic no nitrateEnvironmentalOpen in IMG/M
2088090009Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrateEnvironmentalOpen in IMG/M
3300000205Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_XylanEngineeredOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001781Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Deep SitesEnvironmentalOpen in IMG/M
3300001840Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Shallow Sites - gte1kb - lt4kbEnvironmentalOpen in IMG/M
3300002121Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1EnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300002147Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cyclingHost-AssociatedOpen in IMG/M
3300002529Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank highO2_0.2EnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003702Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial AssemblyEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300009514Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1WEnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025311Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes)EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027951Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by bead beating (SPAdes)Host-AssociatedOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
LWFCA_055926202084038009Freshwater SedimentLACGAGRAAANRTTYPTGWPPFGVTDPRTLGPSKLIYWAKIGFEKWWLWR
LWAnN_040957502088090009Freshwater SedimentAANRTTYPTGWPPFGVTDPRTLGPSKLIYWAKIGFEKWWLWRYF
NICFPass4XylDRAFT_02692223300000205Feedstock Adapted CompostLLAYGAGSAAANRTIYPRGWPPHGTGVSRSWGPSPLLYWAKVGFEKWWLWRYF
JGI10214J12806_1294672813300000891SoilGWPPFGVTDPRTWGPNRAIYWAKVGFEKWWLWRYF*
JGI10216J12902_12212304613300000956SoilAFGAGRAAANRTTYPTGWPPFGVTDPRTLGPSKLIYWAKIGFEKWWLWRYF*
Deep_105150613300001781Hydrothermal Vent PlumeYGAGRAAANRTIYPTGWPPYGAGTSKVWGPSRLVYGAKIAFEKWWLWRYF*
shallow_107103123300001840Hydrothermal Vent PlumeLVAYGAGRAAANRTIYPTGWPPYGGGTSKVWGPSRLVYGAKIAFEKWWLWRYF*
C687J26615_1009796933300002121SoilGRAAANRTTYPQGWPPFGTTEPRTWGPSRSIYWAKIAFEKWWLWRYF*
C687J26631_1004738733300002124SoilGWPPFGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF*
JGI24793J26633_102659123300002147Host-AssociatedANRTTYPQGWPPFGATDSRSWGPSRTIYWSKVLFEKWWLWRYF*
C687J35504_1008830113300002529SoilAGRAAANRTIYPRGWPTFGATEARTWGPSRSIYWAKILFEKWWLWRYF*
JGI25385J37094_1019313913300002558Grasslands SoilPPYDMLLAYGAGRAAANRTIYPQGWPPFGATDARTWGPSRWIYWAKVGFEKWWLWRYF*
JGI25384J37096_1018110523300002561Grasslands SoilYGAGRAAANRTIYPQGWPPFGATDARTWGPSRWIYWAKVGFEKWWLWRYF*
JGI25382J43887_1013446913300002908Grasslands SoilIYPQGWPPFGATDARTWGPSRWIYWAKVGFEKWWLWRYF*
soilL2_1018492473300003319Sugarcane Root And Bulk SoilMNRTIYPQGWPPFAPSYARTWGPSPFIYWAKVMFEKWWLWRYF*
PicMicro_10002430173300003702Marine, Hydrothermal Vent PlumeVAYGAGRAAANRTIYPTGWPPYGAGTSKVWGPSRLVYGAKIAFEKWWLWRYF*
Ga0062592_10126426923300004480SoilNRTTYPTGWPPFGATDPRTLGPSRLIYWAKLGFEKWWLWRYF*
Ga0062380_1025816223300004779Wetland SedimentRTTYPTSWPPFGVTDPRTWGPNKAIYWAKIGFEKWWLWRYF*
Ga0062382_1024501233300004782Wetland SedimentHHMTLAYGAGRAAANRTTYPTGWPPFGVTDPRTWGPNKAIYWAKLGFEKWWLWRYF*
Ga0062594_10112976313300005093SoilLAFGAGRAAANRTTYPTGWPPYGVTDPRTWGPSRMIYWAKIGFEKWWLWRYF*
Ga0066685_1107307423300005180SoilANRTTYPNGWPPFGTGSSRTWGPSPLIYLAKLGFEKWWLWRYF*
Ga0070660_10004781353300005339Corn RhizosphereNRTTYPTGWPPFGVTEPRTWGPSRMIYWAKIGFEKWWLWRYF*
Ga0070659_10210251913300005366Corn RhizosphereGAGRAAANRTTYPTGWPPFGVTEPRTWGPSRMIYWAKIGFEKWWLWRYF*
Ga0070741_100000164043300005529Surface SoilMNRTIYPSGWPPFAATEARTWGPSPFIYWAKIGFEKWWLWRYF*
Ga0066905_10143788113300005713Tropical Forest SoilGRAAANRTTYPTGWPAFGATESRTWGPSRLIYWAKLGFEKWWLWRYF*
Ga0066903_10496132033300005764Tropical Forest SoilAIRTIYPTSWPPFGVTEPRAWGPSRLIYWAKVGFEKWWLWRYF*
Ga0074473_1118380413300005830Sediment (Intertidal)PTGWPPFGATEPRTWGPSRSMYWAKIAFEKWWLWRFF*
Ga0066651_1034247133300006031SoilAMNRTIYPRGWPPFAPTDARTWGPSPFIYWAKILFEKWWLWRYF*
Ga0075421_10003534363300006845Populus RhizosphereLAFGAGRAAANRTIYPSGWPPFGATEARTWGPSKLIYWAKLGFEKWWLWRYF*
Ga0075431_10013987813300006847Populus RhizosphereAFGAGRAAANRTIYPSGWPPFGATEARTWGPSKLIYWAKLGFEKWWLWRYF*
Ga0075433_1026536113300006852Populus RhizosphereYPTGWPPFGATEPRTWGPSRMIYWAKVGFEKWWLWRYF*
Ga0075425_10055972743300006854Populus RhizosphereMNRTIYPSGWPPFAATEARTWGPSPFIYWAKVGFEKWWLWRYF*
Ga0073934_10000656183300006865Hot Spring SedimentLAFGAGRAAANRTTYPTGWPPFGVTDPRTIGPSKLIYWAKIGFEKWWLWRYF*
Ga0105107_1102627723300009087Freshwater SedimentYGAGRAAANRTTYPTGWPPFGITDPRTWGPNKAIYWAKIGFEKWWLWRYF*
Ga0105092_1049398213300009157Freshwater SedimentTVYPTGWPPLGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF*
Ga0105092_1073212823300009157Freshwater SedimentADRAAAIRTIDPAGWPPFGITEPLTGGPSRLIYWAKIGFEKWWLWRYF*
Ga0075423_1017335913300009162Populus RhizosphereGRAAMNRTIYPSGWPPFAATEARTWGPSPFIYWAKVGFEKWWLWRYF*
Ga0075423_1031369833300009162Populus RhizosphereLLAFGAGRAAANRTVYPTGWPPFGVTDSRTWGPSRLIYWAKIGFEKWWLWRYF*
Ga0075423_1060590423300009162Populus RhizosphereMLAFGAGRAAANRTVYPTGWPPFGVTEPRTWGPSRLIYWAKVGFEKWWLWRYF*
Ga0114945_1007491733300009444Thermal SpringsLLAYGAGRAAANRTVYPRGWPPFGTGEARSWGPSRLIYWAKIGFEKWWLWRYF*
Ga0129284_1020913313300009514Beach Aquifer PorewaterGAGRAAANRTTYPTGWPPFGVTEARTWGPSRLIYWAKLGFEKWWLWRYF*
Ga0105347_130934723300009609SoilLAFGAGRAAANRTTYPTGWPPFGVTDPKTLGPSKVIYWAKIGFEKWWLWRYF*
Ga0114999_1083711223300009786MarineTHGAGRASANRTTYPAGWPPFGKPESRAWGPSQLIYGAKIGFEKWWLWRYF*
Ga0134086_1017317013300010323Grasslands SoilRTVYPTGWPPFGVTEPKTWGPSRLIYWAKIGFEKWWLWRYF*
Ga0126376_1220646823300010359Tropical Forest SoilRAAANRTIYPTGWPPFGATEPRTWGPSRLIYWAKVGFEKWWLWRYF*
Ga0126372_1095026723300010360Tropical Forest SoilMNRTIYPQGWPPFAPTDARTWGPSPFIYWAKVLFEKWWLWRYF*
Ga0126378_1120013113300010361Tropical Forest SoilWPPFGVTEPQAWGPSRFIYWAKIGFEKWWLWRYF*
Ga0126378_1231814923300010361Tropical Forest SoilFGAGRAAANRTTYPTGWPPFGATEPRTWGPSRLIYWAKIGFEKWWLWRYF*
Ga0126377_1063507633300010362Tropical Forest SoilTIYPTGWPPFGATEPRTWGPSRLIYWAKIGFEKWWLWRYF*
Ga0126379_1199151413300010366Tropical Forest SoilAAIRTIYPTSWPPFGVTEPRAWGPSRFIYWAKIGFEKWWLWRYF*
Ga0126381_10238601833300010376Tropical Forest SoilAAAIRTIYPTSWPPFGVTEPRAWGPSRFIYWAKIGFEKWWLWRYF*
Ga0126381_10411113423300010376Tropical Forest SoilGRAAAIRTIYPTSWPPFGVTEPRAWGPSRLIYWAKVGFEKWWLWRYF*
Ga0134124_1294504813300010397Terrestrial SoilAANRTTYPTGWPPYGVTDPRTWGPSRMIYWAKIGFEKWWLWRYF*
Ga0126383_1010477013300010398Tropical Forest SoilLAYGAGRAAAIRTIYPTSWPPFGVTEPRAWGPSRLIYWAKVGFEKWWLWRYF*
Ga0134121_1113539513300010401Terrestrial SoilGAGRAAMNRTIYPQGWPNFAPSYARTWGPSPFIYWAKVLFEKWWLWRYF*
Ga0137334_104032123300012179SoilANRTVYPTGWPSFGVADPRTWGPSRLIYWAKIAFEKWWLWRYF*
Ga0137334_106079213300012179SoilGWPPFGVTEPRTWGPSRVIYWAKIGFEKWWLWRYF*
Ga0137371_1084082213300012356Vadose Zone SoilAAANRTVYPTGWPPFGVTEPKTWGPSRLIYWAKIGFEKWWLWRYF*
Ga0137360_1056891813300012361Vadose Zone SoilRAAANRTTYPTGWPPFGATEPRTWGPSRMIYWAKIGFEKWWLWRYF*
Ga0126369_1322564823300012971Tropical Forest SoilAFGAGRAAANRNTYPTGWPPFGATEPRTWGPSRLIYWAKIGFEKWWLWRYF*
Ga0157374_1224527913300013296Miscanthus RhizosphereGRAAANRTTYPTGWPPFGATEPRTWGPSRMIYWAKIGFEKWWLWRYF*
Ga0163162_1306577623300013306Switchgrass RhizosphereAGRAAANRTTYPTGWPPYGVTDPRTWGPSRMIYWAKIGFEKWWLWRYF*
Ga0157377_1009332813300014745Miscanthus RhizosphereAAANRTIYPTGWPPFGVTDPRTWGPNRAIYWAKIGFEKWWLWRYF*
Ga0132256_10162060513300015372Arabidopsis RhizosphereANRTTYPTGWPPFGVTEPRTWGPSRMIYWAKVGFEKWWLWRYF*
Ga0132256_10242702813300015372Arabidopsis RhizospherePTGWPPFGAIEPRSWGPSRMIYWAKVGFEKWWLWRYF*
Ga0132256_10347093423300015372Arabidopsis RhizosphereRTTYPTGWPPFGVTEPRTWGPSRMIYWAKVGFEKWWLWRYF*
Ga0132257_10097861613300015373Arabidopsis RhizosphereLAFGAGRAAANRTTYPTGWPPFGATEPRTWGPSRMIYWAKVGFEKWWLWRYF*
Ga0184634_1048944213300018031Groundwater SedimentLLAYGAGRAAANRTVYPGGWPPFGAGEARSWGPNRLIYWAKIGFEKWWLWRYF
Ga0184634_1051043823300018031Groundwater SedimentGRAAANRTVYPRGWPPFGAGEARSWDPNRLIYWAKIGFEKWWLWRYF
Ga0184637_1025514223300018063Groundwater SedimentLAFGAGRAAANRTTYPNGWPPFGSGSSRSWGPSPLIYLAKVAFEKWWLWRYF
Ga0184611_107391513300018067Groundwater SedimentRTTYPTGWPPFGATEPRTWGPSRMIYWAKVGFEKWWLWRYF
Ga0184632_1030005223300018075Groundwater SedimentAGRAAANRTTYPTGWPPFGVTDPRTWGPSRLIYWAKVGFEKWWLWRYF
Ga0184633_1018757413300018077Groundwater SedimentTYPTGWPPFGVTEARTWGPSRLIYWAKAGFEKWWLWRYF
Ga0184627_1050378423300018079Groundwater SedimentRAAANRTTYPTGWPPFGVTEARTWGPSRLIYLAKISFEKWWLWRYF
Ga0184639_1053898923300018082Groundwater SedimentGAGRAAVNRTTYPTGWPPFGVTDPRTWGPSRLIYWAKVGFEKWWLWRYF
Ga0190271_1087952023300018481SoilFGAGRAAANRTTYPTGWPPFGVTDPRTWGPSRAIYWAKVGFEKWWLWRYF
Ga0193733_110453023300020022SoilTTYPTGWPPFGATEPRTWGPSRMIYWAKIGFEKWWLWRYF
Ga0209109_1012049113300025160SoilRTIYPRGWPPFGATEARTWGPSKAIYWAKVAFEKWWLWRYF
Ga0209642_1015828613300025167SoilYPTGWPPFGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF
Ga0209172_10000953253300025310Hot Spring SedimentLAFGAGRAAANRTTYPTGWPPFGVTDPRTIGPSKLIYWAKIGFEKWWLWRYF
Ga0209343_1012739143300025311GroundwaterANRTIYPTGWPPFGVTEARTWGPSRLIYWAKIGFEKWWLWRYF
Ga0209641_1112037513300025322SoilPRSWPPFGETEPRTWGPSRMLYWAKIAFEKWWLWRYF
Ga0209342_1009844913300025326SoilTVYPTGWPPFGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF
Ga0207680_1091533313300025903Switchgrass RhizosphereGWPPFGVTEPRTWGPSRMIYWAKIGFEKWWLWRYF
Ga0207684_1136907913300025910Corn, Switchgrass And Miscanthus RhizosphereGWPPFGATEPRTWGPSRMIYWAKIGFEKWWLWRYF
Ga0207649_1157955023300025920Corn RhizosphereAFGAGRAAANRTTYPTGWPPFGVTEPRTWGPSRMIYWAKIGFEKWWLWRYF
Ga0207690_1034673813300025932Corn RhizosphereNRTTYPTGWPPFGVTEPRTWGPSRMIYWAKIGFEKWWLWRYF
Ga0209237_125697213300026297Grasslands SoilGAGRAAANRTVYPTGWPPFGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF
Ga0209377_100189113300026334SoilPTGWPPFGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF
Ga0209971_102085313300027682Arabidopsis Thaliana RhizosphereSFGAGRAAANRTIYPTGWPPFGVTEARTWGPSKLIYWSKIGFEKWWLWRYF
Ga0209797_1014865813300027831Wetland SedimentYPTSWPPFGVTDPRTWGPNKAIYWAKIGFEKWWLWRYF
Ga0209382_1005358643300027909Populus RhizosphereLAFGAGRAAANRTIYPSGWPPFGATEARTWGPSKLIYWAKLGFEKWWLWRYF
Ga0209382_1106220113300027909Populus RhizosphereLLAFGAGRAAANRTTYPTGWPPFGVTEPRTLGPSRLIYWAKVGFEKWWLWRYF
Ga0209754_100642083300027951Host-AssociatedNRTTYPQGWPPFGATDSRSWGPSRTIYWSKVLFEKWWLWRYF
Ga0299906_1108188313300030606SoilLLAFGAGRAAANRTIYPAGWPPFGATEARTWGPSKLIYWAKIGFEKWWLWRYF
(restricted) Ga0255310_1006266513300031197Sandy SoilTGWPPFGVTDPRTLGPSKLIYWAKLGFEKWWLWRYF
Ga0326597_1061302913300031965SoilLLAFGAGRAAANRTIYPAGWPPFGAAESRAWGPSSLIYLAKIGFEKWWLWRFF
Ga0310897_1064468013300032003SoilYPTGWPPYGVTDPRTWGPSRMIYWAKIGFEKWWLWRYF
Ga0315281_1213518423300032163SedimentSFGAGRAAANRTTYPNGWPPFGSGSSRSWGPSPLIYLAKIGFEKWWLWRYF
Ga0306920_10018037223300032261SoilMTYPTGWPPFGITEPRTWGPSRMIYWAKIGFEKWWLWRYF
Ga0310345_1060737123300032278SeawaterVAYGAGRAAANRTIYPTGWPPYGAGTSKVWGPSRLVYGAKIAFEKWWLWRYF
Ga0310810_1018588633300033412SoilMNRTIYPQGWPPFAATDARTWGPSPFIYWAKLLFEKWWLWRYF
Ga0316619_1136577013300033414SoilTYPTSWPPFGITDPRTWGPNRAIYWAKIGFEKWWLWRYF
Ga0373959_0095324_589_7023300034820Rhizosphere SoilMNRTIYPQGWPPFAATEARTWGPSPFIYWAKVGFEKWW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.