NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002147

3300002147: Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cycling



Overview

Basic Information
IMG/M Taxon OID3300002147 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0099546 | Gp0055081 | Ga0005348
Sample NameHost-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cycling
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size217661949
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHost-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea
TypeHost-Associated
TaxonomyHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationGulf of Piran, Adriatic Sea
CoordinatesLat. (o)45.5099Long. (o)13.56Alt. (m)N/ADepth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002359Metagenome / Metatranscriptome567Y
F011880Metagenome / Metatranscriptome286Y
F015245Metagenome / Metatranscriptome256Y
F030935Metagenome184Y
F036354Metagenome / Metatranscriptome170Y
F096818Metagenome104Y
F105953Metagenome / Metatranscriptome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI24793J26633_1008217All Organisms → cellular organisms → Bacteria3498Open in IMG/M
JGI24793J26633_1012635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2457Open in IMG/M
JGI24793J26633_1021361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1523Open in IMG/M
JGI24793J26633_1023647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1377Open in IMG/M
JGI24793J26633_1024245All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1343Open in IMG/M
JGI24793J26633_1026591Not Available1229Open in IMG/M
JGI24793J26633_1061468All Organisms → cellular organisms → Bacteria620Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI24793J26633_1006968JGI24793J26633_10069684F105953VVYTREPLHVAKGYPAKDERTTAAECLLLKPSEVLEQVEEGLSGGQHFELIENEDLMVEMTVRSDSQRIYHRGFNQDEVAFQLTGQRGTRTTQGEFMLDTGDMLWIPPGCSHRNIGDMLTTRIILYTRNPLTLSREYTSRAEQVGQAG*
JGI24793J26633_1008217JGI24793J26633_10082171F002359MIDYDIADMMDGVKNMIEASDIRPGDQVLLLADRRSDSASMEAISAGLKFMGAEPMSLITEPISRYGRVPQAVLDAMHACDVVIWVWPVFITFTPGHRALGRKREESGTQLKEQRMKPYFIYFEGTPGLLARDYARFPNPVLWKLAEKVREVVAAGKVVRIEDDLGSHLTATYDGTRLYGMQFRAGDPPGRC
JGI24793J26633_1012635JGI24793J26633_10126351F030935RQGSTPVDTARRLGQATPGAELALIPGVRHMTFWDGTGAIEALEDFLARHPIG*
JGI24793J26633_1021361JGI24793J26633_10213613F036354DGGEVLAKRKGDVARHGLKEARSKAATRWTRTGYEACAAGRAGK*
JGI24793J26633_1023647JGI24793J26633_10236472F011880MATKEQIEAAEKRVYSQKDIGEFMTTWKDFPRPGLAAWSERKKAGLMNTARSTRYTPKFRPFDMLSVPNQSLVFLENENHRIGAESVVGVQDAFHRYVDCDMVYFQFCGNTTVETEFGVYEMTPGEVMLVPGGISHRSIGRNDSLRYFCLNREAVDYVLDEEKYTSHQSFVVKRHGGPNWSGLEAPNEEVRGRVTEKMHFWDDGPDDLTVVERDYDSLVGVSTLKPKQQESGIRKLRAFDHFTMVLGKAGGEAGLLALMESQSMRVRTYNMQDEQFAFHRALQSEEVRIQFRGDALDLSEFENVAVSPGEITIIPLGISHSVISVPPDSEDFLRLNFYSKLRWHVPIDPTRHVYNSTFTVETTVHKEADWWKTAANA*
JGI24793J26633_1024245JGI24793J26633_10242453F015245ELPAPMKWVVKDSEVVEAEGGELAEECRQLFKNVPGSNRLVEIMFGYHPKASIQHGIADPMHWELISKMPWVGLGTDRKNPDFRHVDGSVMNARLYIDERLIVHEQGMLDRSLLHHPEVLEAASAYGDPYQVLAPVSHNAHGSGTLW*
JGI24793J26633_1026591JGI24793J26633_10265912F096818ANRTTYPQGWPPFGATDSRSWGPSRTIYWSKVLFEKWWLWRYF*
JGI24793J26633_1061468JGI24793J26633_10614681F030935VGTARMLGQAIPGAELALIPGVRHMTFWDGTGALTALQDFLKRHPIQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.