NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097993

Metagenome Family F097993

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097993
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 38 residues
Representative Sequence MTETPHKTGPAWAEFSDDVRESVEIVRTAAIEAPCRAA
Number of Associated Samples 83
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 85.58 %
% of genes near scaffold ends (potentially truncated) 23.08 %
% of genes from short scaffolds (< 2000 bps) 65.38 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.308 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(29.808 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.846 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.88%    β-sheet: 0.00%    Coil/Unstructured: 62.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF01590GAF 29.81
PF00990GGDEF 6.73
PF04909Amidohydro_2 3.85
PF00120Gln-synt_C 2.88
PF04075F420H2_quin_red 2.88
PF00563EAL 2.88
PF00535Glycos_transf_2 1.92
PF00296Bac_luciferase 1.92
PF13426PAS_9 0.96
PF12680SnoaL_2 0.96
PF00440TetR_N 0.96
PF01738DLH 0.96
PF00378ECH_1 0.96
PF02780Transketolase_C 0.96
PF01565FAD_binding_4 0.96
PF16751RsdA_SigD_bd 0.96
PF01965DJ-1_PfpI 0.96
PF08241Methyltransf_11 0.96
PF00881Nitroreductase 0.96
PF08240ADH_N 0.96
PF00931NB-ARC 0.96
PF02702KdpD 0.96
PF13185GAF_2 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 2.88
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 2.88
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 2.88
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 2.88
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.92
COG2205K+-sensing histidine kinase KdpDSignal transduction mechanisms [T] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.31 %
UnclassifiedrootN/A7.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001131|JGI12631J13338_1001233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae6676Open in IMG/M
3300001867|JGI12627J18819_10144911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii969Open in IMG/M
3300002245|JGIcombinedJ26739_100006541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. JS6239090Open in IMG/M
3300004152|Ga0062386_101031931Not Available682Open in IMG/M
3300005610|Ga0070763_10004222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales5441Open in IMG/M
3300005764|Ga0066903_100697540All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300005764|Ga0066903_103218622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae883Open in IMG/M
3300005764|Ga0066903_105444031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia672Open in IMG/M
3300006052|Ga0075029_100392977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales900Open in IMG/M
3300006102|Ga0075015_100097896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1469Open in IMG/M
3300006102|Ga0075015_100369145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium804Open in IMG/M
3300006172|Ga0075018_10018672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2661Open in IMG/M
3300009633|Ga0116129_1004391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium6493Open in IMG/M
3300009784|Ga0123357_10471594Not Available1069Open in IMG/M
3300009826|Ga0123355_11172179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium788Open in IMG/M
3300009826|Ga0123355_11778242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium583Open in IMG/M
3300010048|Ga0126373_10442394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1333Open in IMG/M
3300010049|Ga0123356_11049460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium984Open in IMG/M
3300010049|Ga0123356_11070382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium975Open in IMG/M
3300010339|Ga0074046_10323365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium944Open in IMG/M
3300010341|Ga0074045_10162169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1513Open in IMG/M
3300010376|Ga0126381_103049337Not Available664Open in IMG/M
3300016319|Ga0182033_11930994Not Available537Open in IMG/M
3300016341|Ga0182035_11697107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium genavense571Open in IMG/M
3300016357|Ga0182032_10011202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. UM_CSW4853Open in IMG/M
3300016357|Ga0182032_10040336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2947Open in IMG/M
3300016357|Ga0182032_11664332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium556Open in IMG/M
3300016371|Ga0182034_10002685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium9124Open in IMG/M
3300016371|Ga0182034_10114528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1962Open in IMG/M
3300017822|Ga0187802_10046403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1580Open in IMG/M
3300017942|Ga0187808_10018190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2819Open in IMG/M
3300017946|Ga0187879_10060388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2215Open in IMG/M
3300017959|Ga0187779_11172872All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300017961|Ga0187778_10141355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1514Open in IMG/M
3300017972|Ga0187781_10093458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2083Open in IMG/M
3300017972|Ga0187781_10147047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1653Open in IMG/M
3300017973|Ga0187780_10423273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium946Open in IMG/M
3300018009|Ga0187884_10256951Not Available711Open in IMG/M
3300018058|Ga0187766_10036324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2871Open in IMG/M
3300018086|Ga0187769_10018376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium4601Open in IMG/M
3300018086|Ga0187769_10819891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium703Open in IMG/M
3300018088|Ga0187771_10317629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1306Open in IMG/M
3300018090|Ga0187770_11250634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium601Open in IMG/M
3300020582|Ga0210395_10008702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium7625Open in IMG/M
3300020582|Ga0210395_10050765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium3038Open in IMG/M
3300020582|Ga0210395_10560935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium858Open in IMG/M
3300020582|Ga0210395_10819397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales694Open in IMG/M
3300021170|Ga0210400_10576146Not Available928Open in IMG/M
3300021401|Ga0210393_10647424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium862Open in IMG/M
3300021405|Ga0210387_10725033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium881Open in IMG/M
3300021478|Ga0210402_10305997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1472Open in IMG/M
3300021560|Ga0126371_12082481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium683Open in IMG/M
3300024288|Ga0179589_10178172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium920Open in IMG/M
3300025463|Ga0208193_1015028All Organisms → cellular organisms → Bacteria2242Open in IMG/M
3300027093|Ga0208093_102936Not Available789Open in IMG/M
3300027376|Ga0209004_1012885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1264Open in IMG/M
3300027439|Ga0209332_1085029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium571Open in IMG/M
3300027502|Ga0209622_1090973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium559Open in IMG/M
3300027537|Ga0209419_1100860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium575Open in IMG/M
3300027583|Ga0209527_1001524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4708Open in IMG/M
3300027609|Ga0209221_1102422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium736Open in IMG/M
3300027701|Ga0209447_10016379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2099Open in IMG/M
3300027783|Ga0209448_10016732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2392Open in IMG/M
3300027824|Ga0209040_10009780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6752Open in IMG/M
3300027824|Ga0209040_10061705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2222Open in IMG/M
3300027895|Ga0209624_10027999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium3581Open in IMG/M
3300027911|Ga0209698_10107191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2332Open in IMG/M
3300031543|Ga0318516_10000808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium10784Open in IMG/M
3300031543|Ga0318516_10001572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium8905Open in IMG/M
3300031544|Ga0318534_10106951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1603Open in IMG/M
3300031544|Ga0318534_10320408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium893Open in IMG/M
3300031546|Ga0318538_10443767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium703Open in IMG/M
3300031573|Ga0310915_10012120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. UM_CSW5036Open in IMG/M
3300031682|Ga0318560_10009723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium4094Open in IMG/M
3300031715|Ga0307476_10323680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1133Open in IMG/M
3300031718|Ga0307474_10162474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1689Open in IMG/M
3300031718|Ga0307474_10532272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium923Open in IMG/M
3300031751|Ga0318494_10901003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium519Open in IMG/M
3300031754|Ga0307475_10142785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1897Open in IMG/M
3300031754|Ga0307475_10484455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae993Open in IMG/M
3300031763|Ga0318537_10003632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium4957Open in IMG/M
3300031765|Ga0318554_10039935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium interjectum2546Open in IMG/M
3300031768|Ga0318509_10523262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium662Open in IMG/M
3300031778|Ga0318498_10022745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2672Open in IMG/M
3300031793|Ga0318548_10000640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium9827Open in IMG/M
3300031793|Ga0318548_10370724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium702Open in IMG/M
3300031890|Ga0306925_10442911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1389Open in IMG/M
3300031894|Ga0318522_10290272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium620Open in IMG/M
3300031896|Ga0318551_10756052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium564Open in IMG/M
3300031912|Ga0306921_12003567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium616Open in IMG/M
3300031954|Ga0306926_10115944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium3297Open in IMG/M
3300031962|Ga0307479_10682341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1007Open in IMG/M
3300032010|Ga0318569_10266848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium796Open in IMG/M
3300032068|Ga0318553_10021873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium interjectum2986Open in IMG/M
3300032076|Ga0306924_10981990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium928Open in IMG/M
3300032261|Ga0306920_101385462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1008Open in IMG/M
3300032261|Ga0306920_104148949Not Available523Open in IMG/M
3300032783|Ga0335079_10776836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium994Open in IMG/M
3300032805|Ga0335078_12607294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium518Open in IMG/M
3300032829|Ga0335070_10025635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium6767Open in IMG/M
3300032893|Ga0335069_10282322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium innocens1983Open in IMG/M
3300032895|Ga0335074_10824226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium860Open in IMG/M
3300032896|Ga0335075_10002512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae29435Open in IMG/M
3300032896|Ga0335075_10071650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales4691Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil10.58%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland9.62%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.73%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.81%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.81%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut4.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.92%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001131Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009784Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4Host-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025463Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027093Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF021 (SPAdes)EnvironmentalOpen in IMG/M
3300027376Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12631J13338_100123363300001131Forest SoilMTETPHKTGPASAEFCDDVLESVEIVCTAAIEAPCRAA*
JGI12627J18819_1014491123300001867Forest SoilMTETPHKAGPALGEFSDDGLESVETVRTAAMGAPCRAA*
JGIcombinedJ26739_10000654173300002245Forest SoilMFEEPTMTETPHQNGPAWVEFSDEVLASIEAVRTAAIEAPCRAA*
Ga0062386_10103193123300004152Bog Forest SoilLRSPTMAVPHKTGLAWAEFSDDVLEAVEIVPTGAIGEPCRPT*
Ga0070763_1000422223300005610SoilMTETPHKTGPAWAEFCDDVRESAEIICTAAIEAPCRAA*
Ga0066903_10069754033300005764Tropical Forest SoilMMPGTETRQKTWPTWAEFADEMPESVATVRTAAIEAPCRAA*
Ga0066903_10321862223300005764Tropical Forest SoilMTETPRKTGQAWAEFSDDVLESVEAVRTAAIEAPCRAA*
Ga0066903_10544403113300005764Tropical Forest SoilMTEALHKTEPAPIEFSDDLLESVETVSTAAIEAPCRAA*
Ga0075029_10039297723300006052WatershedsMAVPHKTGLAWAEFSDDVLSDDLLEAVEIVPTGAIEEPCRPT*
Ga0075015_10009789623300006102WatershedsMAVPHKTGLAWAEFSDDVLEAVEIVRTAAIEETCRPI*
Ga0075015_10036914513300006102WatershedsYLRSPTMAVPHKTGLAWAEFSDDVLSDDLLEAVEIVPTGAIEEPCRPT*
Ga0075018_1001867223300006172WatershedsMTEAPDKPAWVEFCADVLESLESVESVHTAAIEAPCCAA*
Ga0116129_100439123300009633PeatlandMTETPHKTGPAWAELCDDVLESVEIVCTAAIEAPCRAA*
Ga0123357_1047159433300009784Termite GutMAETPQNTGSPQADSSDDLLESVEIVRTAAIETPWRAA*
Ga0123355_1117217923300009826Termite GutMTETPRKTGSPQAGFSDGVLASVEIVRTAAIEAPWRAG*
Ga0123355_1177824213300009826Termite GutSPGCLRSPTMAETPQNTGSPQADSSDDLLESVEIVRTAAIETPWRAA*
Ga0126373_1044239423300010048Tropical Forest SoilMMPGTETRQKTWPTWAEFSDEVPESGATVRTAAIEAPCRAA*
Ga0123356_1104946023300010049Termite GutMTETPQKTGSSQAEFSDGVLASVEIVRTAAIEAPWRVA*
Ga0123356_1107038223300010049Termite GutMAETPQKAGSPQADSSDDVLESVEIVRTVAIEAPWRAA*
Ga0074046_1032336523300010339Bog Forest SoilMAVPHKTGLAWAEFSDDVLEAVEIVPTGAIGEPCRPT*
Ga0074045_1016216933300010341Bog Forest SoilMTETPHKTGSARAEFSDGVRESVETVREAVIEVPWRAA*
Ga0126381_10304933713300010376Tropical Forest SoilMMPGTETRQKTWPTWAEFADEMPESVATVRTAAIEAPCRA
Ga0182033_1193099413300016319SoilMTETPHKTGPVSAEFSADVLESVEIVRAAPIEEPC
Ga0182035_1169710723300016341SoilMTETPHKTGPTSAEFSDAVRESVEIVRTAPIEEPWRAA
Ga0182032_1001120263300016357SoilMTQTPHKTGSVWAEFSGDLPESVEIVRTAAIEAPCR
Ga0182032_1004033633300016357SoilMAQTPHKTGSVWAEFSGDLPESVEIVRTLAIEAPCSVA
Ga0182032_1166433213300016357SoilMTQTPHKTGSAWAEFSGDVTESVEIVRTLAIEAPCRVA
Ga0182034_1000268543300016371SoilMTETPHKTGPTSAEFSAAVRESVEIVRTAPIEEPWRAA
Ga0182034_1011452823300016371SoilCWRSPQMAQTPHKTGSVWAEFSGDLPESVEIVRTLAIEAPCRVA
Ga0187802_1004640323300017822Freshwater SedimentMTETPHKTGLAWAEFPDDVLEAVEIVRTAAIEVPCRA
Ga0187808_1001819033300017942Freshwater SedimentMTETPHKTGLAWAEFPDDVLEAVEIVRTAAIEVPCRAA
Ga0187879_1006038823300017946PeatlandMTETPHKTGLAWVEFSDDVLESVETVLTAAIEGPCRAA
Ga0187779_1117287213300017959Tropical PeatlandMTKTRHKTGPAWAECFDGVLESVETVRTAAIEAPCRAA
Ga0187778_1014135513300017961Tropical PeatlandMTETRPKTGPAWVEFSIDVLESVETVRTTAIEAPCRAG
Ga0187781_1009345823300017972Tropical PeatlandMPETRDKTGPAWAESSDDVRERVEAARKAAIEAPCSTS
Ga0187781_1014704723300017972Tropical PeatlandMTETPHKTGLACAEFADDVLEAVDIVRTAAIEEPCRAA
Ga0187780_1042327323300017973Tropical PeatlandMTETPHKTGLAWAEFADDVLEAVEIVRTAAIEEPCRAA
Ga0187884_1025695123300018009PeatlandMTETPHKTGPAWAEFCDDVRESAEIICTAAIEAPCRAA
Ga0187766_1003632423300018058Tropical PeatlandMTKTRHKTGPAWAEFSDDVLESVQTVRTAAIEAPCRAA
Ga0187769_1001837623300018086Tropical PeatlandMTETPHKTGLAWAEFADDVLESVEIVCTAAIEAPCRAA
Ga0187769_1081989113300018086Tropical PeatlandTLHKTGPARAEFSDDVREPVEAARKAAIEVPWRAA
Ga0187771_1031762923300018088Tropical PeatlandMTETPHKTRPAWAGFCDDVRESVEIVRTAAIEAPCGAA
Ga0187770_1125063413300018090Tropical PeatlandTETPHKTGLAWAKFADDVLEAVEIVRTAAIEEPCRAA
Ga0210395_1000870213300020582SoilMTETPHKTGPVWAELPDDVLESVEIVRIAAIGEPCRAA
Ga0210395_1005076543300020582SoilMTETQRKTEPAWAEFCDDALESVAIVRTAAIESPCRAT
Ga0210395_1056093523300020582SoilMTETAHQTGPAWAEFSDDVIESVEIVRIAAIEAPWRGA
Ga0210395_1081939723300020582SoilMAVPHKTGLAWAEFSDDVLEAVEIVPTGAIGGPCRPT
Ga0210400_1057614613300021170SoilMMPGMATPHKTEPAWAELPDDVPESVATVRTATIEAACRAG
Ga0210393_1064742423300021401SoilMTETPHKTGPVWAEFPDDVLESVEIVRIAAIGEPCRAA
Ga0210387_1072503323300021405SoilMALPHKTGLAWAEFSDDVLEAVEIVPTGAIGEPWRPT
Ga0210402_1030599723300021478SoilMAVPHKTGLAWAEFSDDVLEAVEIVPTGAIGEPCRPT
Ga0126371_1208248113300021560Tropical Forest SoilMTAIPHKTGPAGAEFSDDVLETVETVRTTAIEAPCRAA
Ga0179589_1017817213300024288Vadose Zone SoilSPTMTETPHKTRLAWAEFSDDVLESGETVRTAVIEAPCRAA
Ga0208193_101502823300025463PeatlandMTETPHKTGPAWAELCDDVLESVEIVCTAAIEAPCRAA
Ga0208093_10293623300027093Forest SoilMTETPHKTGPVWAELPDDVLESVEIVRIAAIGEPC
Ga0209004_101288533300027376Forest SoilMTETPHKTGPEWAEFSDDVIESVEIVRIAAIEAPCGAA
Ga0209332_108502913300027439Forest SoilMTETPHKTGLTWVEFSDDVLESVETVLTAAIEGPCRAA
Ga0209622_109097323300027502Forest SoilMTETPHKAGPALGEFSDDGLESVETVRTAAMGAPCRAA
Ga0209419_110086013300027537Forest SoilWMFEEPTMTETPHQNGPAWVEFSDEVLASIEAVRTAAIEAPCRAA
Ga0209527_100152423300027583Forest SoilMTETPHQNGPAWVEFSDEVLASIEAVRTAAIEAPCRAA
Ga0209221_110242223300027609Forest SoilMTETPHKTGPASAEFCDDVLESVEIVCTAAIEAPCRAA
Ga0209447_1001637923300027701Bog Forest SoilMTEPPHKTGPAWAEFSDDVLESVEIVCTAAIEAPCRAA
Ga0209448_1001673223300027783Bog Forest SoilMTETPHKTGPARAEFSDDVRESVEIVCTAAIEAPCRAA
Ga0209040_1000978043300027824Bog Forest SoilMTETAHKTGPVWAELPDDVLESVEIVRIAAIGEPCRAA
Ga0209040_1006170523300027824Bog Forest SoilMTETPHKTRLAWAEFSDDVLESVETVRTAAIEAPCRAA
Ga0209624_1002799953300027895Forest SoilMTETPHKTGPAWAEFCDDVLESVEIVCTAAIEAPCRAA
Ga0209698_1010719113300027911WatershedsMAVPHKTGLAWAEFSDDVLSDDLLEAVEIVPTGAIEEPCRPT
Ga0318516_1000080823300031543SoilMAQTPHKTGSVWAEFCGDVPESVEIVRTAAIEAPCRAA
Ga0318516_1000157263300031543SoilMTETPHKTGPTSAEFSDAVRESVEIVRIAPIEEPWRAA
Ga0318534_1010695123300031544SoilMAQTPHKTGSVWAEFSGDLPESVEIVRTLAIEAPCRVA
Ga0318534_1032040813300031544SoilGCWRSPQMAQTPHKTGSVWAEFCGDVPESVEIVRTAAIEAPCRAA
Ga0318538_1044376713300031546SoilMTETAHKTGPACAEFSDDVIESVEIVRIAAIEAPCGAA
Ga0310915_1001212053300031573SoilMTQTPHKTGSVWAEFSGDLPESVEIVRTLAIEAPCRVA
Ga0318560_1000972313300031682SoilTQTPHKTGSAWAEFSGDLPESVEIVRTLAIEAPCRVA
Ga0307476_1032368023300031715Hardwood Forest SoilMTETPHRTGPPWAEFSADVLESVEIVRTAAIESLCSAT
Ga0307474_1016247423300031718Hardwood Forest SoilMTETPHKTGSAWAEFSDDVLESVEIVRSAAIEEPCRAA
Ga0307474_1053227213300031718Hardwood Forest SoilMTETPHRTGPAWAEFSADVLESVEIVRTAAIESLCSAT
Ga0318494_1090100323300031751SoilMTQTPHKTGSVWAEFCGDVPESVEIVRTAAIEAPCRVA
Ga0307475_1014278533300031754Hardwood Forest SoilMTGTPHKTGSAWAEFCDGALESVEIVRSAAIEARCRAA
Ga0307475_1048445523300031754Hardwood Forest SoilMTETPHKTGPAWAKFSDDVLESVEIVRSAAIEEPCRAA
Ga0318537_1000363223300031763SoilMAQTPHKTGSVWAEFSGDLPESVEIVRTSAIEAPCRVA
Ga0318554_1003993513300031765SoilMAQTPHKTGSVWAEFSGDLPESVEIVRTAAIEAPCR
Ga0318509_1052326223300031768SoilETPHKTGPTSAEFSAAVRESVEIVRTAPIEEPWRAA
Ga0318498_1002274533300031778SoilMAQTPHKTGSVWAEFCGDVPESVEIVRTAAIEAPCRVA
Ga0318548_10000640133300031793SoilMAQTPHKTGSVWAEFSGDLPESVEIVRTAAIEAPCRAA
Ga0318548_1037072423300031793SoilQTPHKTGSVWAEFSGDVPESVEIVRTAAIEAPCRVA
Ga0306925_1044291123300031890SoilMTETPDTTGPAWAELSDDVLDSVEIVPTTAFEAPWRAA
Ga0318522_1029027223300031894SoilMTQTPHKTGSVWAEFSGDVPESVEIVRTAAIEAPCRVA
Ga0318551_1075605223300031896SoilMTQTPHKTGSVWAEFSGDLPESVEIVRTAAIEAPCRAA
Ga0306921_1200356713300031912SoilMTQTPHKTGSVWAEFCGDVPESVEIVRTAAIEAPC
Ga0306926_1011594423300031954SoilMAQTPHKTGSVWAEFSGDLPESVEIVRTAAIEAPCRVA
Ga0307479_1068234123300031962Hardwood Forest SoilMTETPHKTGPAWAEFSDDVRESVEIVRTAAIEAPCRAA
Ga0318569_1026684813300032010SoilMTQTPHKTGSVWAEFCGDVPESVEIVRTAAIEAPCRV
Ga0318553_1002187333300032068SoilMAQTPHKTGSVWAEFCGDVPESVEIVRTAAIEAPCR
Ga0306924_1098199013300032076SoilKRHEARPACAEFSDDVFEAVETVCTAAIEAPCREG
Ga0306920_10138546213300032261SoilCLRSPTMTETAHKTGPACAEFSDDVIESVEIVRIAAIEAPCGAA
Ga0306920_10414894913300032261SoilMTETAHKTGPACAEFSDDVIESVEIVRIAAIEAPCG
Ga0335079_1077683623300032783SoilTETPHKSGLAWAELTDDALEAVEIIRTAAIEDPCRAT
Ga0335078_1260729423300032805SoilMTETPHKSGLAWAELTDDALEAVEIIRTAAIEDPCRAT
Ga0335070_1002563563300032829SoilMTETPHKTGPAWTEFAGDVLESVKVACAAAIEAPCRAA
Ga0335069_1028232233300032893SoilMTEALHKTGPAWAKFSDDVLESVETVRTAAIEAPCRAA
Ga0335074_1082422623300032895SoilMTETPRKTGQAWAEFSDDVLESVEALRTATIEALCRAV
Ga0335075_10002512253300032896SoilMTETPHKTGSAWVEFSDDVLESVEMLCTAAIEAPCCAG
Ga0335075_1007165023300032896SoilMTATPHKTGPAWVEFSDDVLESVEMLRTAAIESPCCAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.