NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F099158

Metagenome Family F099158

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099158
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 64 residues
Representative Sequence MILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYAGTEGRMPRFVK
Number of Associated Samples 90
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 82.52 %
% of genes near scaffold ends (potentially truncated) 23.30 %
% of genes from short scaffolds (< 2000 bps) 67.96 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.77

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (47.573 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater
(35.922 % of family members)
Environment Ontology (ENVO) Unclassified
(67.961 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(73.786 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.28%    β-sheet: 28.72%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.77
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.15.9.0: automated matchesd5zlia15zli0.55973
b.142.1.1: Type II restriction endonuclease effector domaind1na6a11na60.55744
d.15.1.5: Ras-binding domain, RBDd1e7ua31e7u0.55429
b.142.1.2: B3 DNA binding domaind5os9a_5os90.54117
d.113.1.1: MutT-liked1u20a11u200.53739

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF01227GTP_cyclohydroI 3.88
PF14743DNA_ligase_OB_2 2.91
PF09414RNA_ligase 1.94
PF09511RNA_lig_T4_1 1.94
PF10431ClpB_D2-small 1.94
PF09694Gcw_chp 0.97
PF01242PTPS 0.97
PF01050MannoseP_isomer 0.97
PF137592OG-FeII_Oxy_5 0.97
PF03496ADPrib_exo_Tox 0.97
PF07486Hydrolase_2 0.97
PF03819MazG 0.97
PF14235DUF4337 0.97
PF03477ATP-cone 0.97
PF03815LCCL 0.97
PF00268Ribonuc_red_sm 0.97
PF02915Rubrerythrin 0.97
PF13450NAD_binding_8 0.97
PF01176eIF-1a 0.97
PF07282OrfB_Zn_ribbon 0.97
PF02353CMAS 0.97
PF13353Fer4_12 0.97
PF08443RimK 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 0.97
COG3773Cell wall hydrolase CwlJ, involved in spore germinationCell cycle control, cell division, chromosome partitioning [D] 0.97
COG5585Putative phage head morphogenesis protein, F of phage Mu or gp7 of SPP1Mobilome: prophages, transposons [X] 0.97
COG0208Ribonucleotide reductase beta subunit, ferritin-like domainNucleotide transport and metabolism [F] 0.97
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 0.97
COG07206-pyruvoyl-tetrahydropterin synthaseCoenzyme transport and metabolism [H] 0.97
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.97
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.43 %
UnclassifiedrootN/A47.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003375|JGI26470J50227_1043538Not Available819Open in IMG/M
3300003650|SLW30_101006All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3156Open in IMG/M
3300003787|Ga0007811_1000761All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4888Open in IMG/M
3300003787|Ga0007811_1001984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2790Open in IMG/M
3300003787|Ga0007811_1018794Not Available604Open in IMG/M
3300003797|Ga0007846_1001628Not Available3226Open in IMG/M
3300003806|Ga0007864_1019431Not Available500Open in IMG/M
3300003814|Ga0007877_1033210Not Available542Open in IMG/M
3300003815|Ga0007856_1006102All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage871Open in IMG/M
3300004481|Ga0069718_15957409Not Available529Open in IMG/M
3300004777|Ga0007827_10106221Not Available631Open in IMG/M
3300004804|Ga0007796_10099676Not Available899Open in IMG/M
3300005662|Ga0078894_10774679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage841Open in IMG/M
3300006029|Ga0075466_1005770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4406Open in IMG/M
3300006030|Ga0075470_10104217Not Available847Open in IMG/M
3300006037|Ga0075465_10017255Not Available1398Open in IMG/M
3300006072|Ga0007881_1020416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1853Open in IMG/M
3300006100|Ga0007806_1017811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1522Open in IMG/M
3300006103|Ga0007813_1095081Not Available575Open in IMG/M
3300006108|Ga0007862_1105287All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. JS-Safj-400b-B2526Open in IMG/M
3300006111|Ga0007848_1009861All Organisms → Viruses → Predicted Viral2014Open in IMG/M
3300006112|Ga0007857_1070254Not Available651Open in IMG/M
3300006117|Ga0007818_1097618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300006119|Ga0007866_1024107All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1239Open in IMG/M
3300006641|Ga0075471_10628485Not Available526Open in IMG/M
3300006805|Ga0075464_10416122Not Available818Open in IMG/M
3300006920|Ga0070748_1159763Not Available836Open in IMG/M
3300007538|Ga0099851_1035599All Organisms → Viruses → Predicted Viral1984Open in IMG/M
3300008111|Ga0114344_1005861All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes10816Open in IMG/M
3300008448|Ga0114876_1232867Not Available589Open in IMG/M
3300009009|Ga0105105_10308653All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300009081|Ga0105098_10464226Not Available639Open in IMG/M
3300009151|Ga0114962_10002239All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes16260Open in IMG/M
3300009152|Ga0114980_10000401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes31409Open in IMG/M
3300009159|Ga0114978_10009744Not Available7444Open in IMG/M
3300009165|Ga0105102_10926043Not Available504Open in IMG/M
3300009181|Ga0114969_10341840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis flava871Open in IMG/M
3300009182|Ga0114959_10151572All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1231Open in IMG/M
3300009182|Ga0114959_10229938All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage948Open in IMG/M
3300009502|Ga0114951_10642422Not Available505Open in IMG/M
3300010160|Ga0114967_10513040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300010316|Ga0136655_1137235Not Available731Open in IMG/M
3300010885|Ga0133913_10073746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9156Open in IMG/M
3300010885|Ga0133913_10711761All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2626Open in IMG/M
3300012347|Ga0157142_1001433Not Available5768Open in IMG/M
3300012664|Ga0157497_1002182All Organisms → Viruses → Predicted Viral3461Open in IMG/M
3300012665|Ga0157210_1000303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes22811Open in IMG/M
3300012667|Ga0157208_10006955Not Available1712Open in IMG/M
3300013093|Ga0164296_1016104All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5044Open in IMG/M
3300013285|Ga0136642_1000016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes117351Open in IMG/M
3300013286|Ga0136641_1000012All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes80059Open in IMG/M
3300020205|Ga0211731_10950974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis flava2061Open in IMG/M
3300020686|Ga0214194_111167Not Available796Open in IMG/M
3300020727|Ga0214246_1053420Not Available596Open in IMG/M
3300021131|Ga0214206_1006382All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1908Open in IMG/M
3300021138|Ga0214164_1033511Not Available1260Open in IMG/M
3300021349|Ga0194052_1069289All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1325Open in IMG/M
3300021519|Ga0194048_10148637Not Available881Open in IMG/M
3300021519|Ga0194048_10184691Not Available775Open in IMG/M
3300021520|Ga0194053_10224976Not Available741Open in IMG/M
3300021962|Ga0222713_10549050Not Available683Open in IMG/M
3300021963|Ga0222712_10235488All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1179Open in IMG/M
3300022072|Ga0196889_1008804All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2248Open in IMG/M
3300022602|Ga0248169_100580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage56938Open in IMG/M
3300022602|Ga0248169_107720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9384Open in IMG/M
3300022743|Ga0228699_1006807Not Available3336Open in IMG/M
3300025336|Ga0208619_111163Not Available657Open in IMG/M
3300025357|Ga0208383_1000198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes11844Open in IMG/M
3300025369|Ga0208382_1014962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1125Open in IMG/M
3300025372|Ga0207957_1000003Not Available128309Open in IMG/M
3300025379|Ga0208738_1000124All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage24344Open in IMG/M
3300025379|Ga0208738_1000229All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17073Open in IMG/M
3300025379|Ga0208738_1000797Not Available7753Open in IMG/M
3300025381|Ga0208871_1014231All Organisms → Viruses → Predicted Viral1264Open in IMG/M
3300025389|Ga0208257_1044998Not Available628Open in IMG/M
3300025392|Ga0208380_1044186Not Available661Open in IMG/M
3300025392|Ga0208380_1065927Not Available502Open in IMG/M
3300025410|Ga0208875_1004935Not Available2651Open in IMG/M
3300025411|Ga0208865_1054725Not Available616Open in IMG/M
3300025449|Ga0208106_1015336All Organisms → Viruses → Predicted Viral1519Open in IMG/M
3300025449|Ga0208106_1022722Not Available1213Open in IMG/M
3300025449|Ga0208106_1038882Not Available877Open in IMG/M
3300025451|Ga0208426_1011951Not Available1262Open in IMG/M
3300025451|Ga0208426_1031230Not Available811Open in IMG/M
3300025487|Ga0208105_1039523Not Available859Open in IMG/M
3300025606|Ga0207954_1105267Not Available695Open in IMG/M
3300025645|Ga0208643_1044765Not Available1386Open in IMG/M
3300025723|Ga0208741_10092665Not Available685Open in IMG/M
3300025778|Ga0208388_1062883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300025779|Ga0208869_1011291All Organisms → Viruses → Predicted Viral1316Open in IMG/M
3300025896|Ga0208916_10179516Not Available914Open in IMG/M
3300027708|Ga0209188_1000050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes138091Open in IMG/M
3300027762|Ga0209288_10335951Not Available505Open in IMG/M
3300027782|Ga0209500_10017380All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4256Open in IMG/M
(restricted) 3300027970|Ga0247837_1172527All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → Janthinobacterium agaricidamnosum → Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628931Open in IMG/M
3300027973|Ga0209298_10005280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7398Open in IMG/M
3300031759|Ga0316219_1023455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2892Open in IMG/M
3300031884|Ga0316220_1042525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1922Open in IMG/M
3300032665|Ga0316221_1128307All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum899Open in IMG/M
3300032668|Ga0316230_1078155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1363Open in IMG/M
3300032722|Ga0316231_1123803All Organisms → Viruses → Predicted Viral1222Open in IMG/M
3300032753|Ga0316224_1173019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage736Open in IMG/M
3300032753|Ga0316224_1181431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater35.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake11.65%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater7.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.88%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater1.94%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.94%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.97%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.97%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.97%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.97%
Subglacial FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater0.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.97%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003375Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6EnvironmentalOpen in IMG/M
3300003650Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filterEnvironmentalOpen in IMG/M
3300003787Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09EnvironmentalOpen in IMG/M
3300003797Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07EnvironmentalOpen in IMG/M
3300003806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07EnvironmentalOpen in IMG/M
3300003814Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09EnvironmentalOpen in IMG/M
3300003815Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006072Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09EnvironmentalOpen in IMG/M
3300006100Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09EnvironmentalOpen in IMG/M
3300006103Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09EnvironmentalOpen in IMG/M
3300006108Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07EnvironmentalOpen in IMG/M
3300006111Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08EnvironmentalOpen in IMG/M
3300006112Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08EnvironmentalOpen in IMG/M
3300006117Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09EnvironmentalOpen in IMG/M
3300006119Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012347Freshwater microbial communities from Fish Creek, Ontario, Canada - S48EnvironmentalOpen in IMG/M
3300012664Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012667Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15EnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300013285Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31YEnvironmentalOpen in IMG/M
3300013286Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23YEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020686Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnionEnvironmentalOpen in IMG/M
3300020727Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnionEnvironmentalOpen in IMG/M
3300021131Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnionEnvironmentalOpen in IMG/M
3300021138Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300021349Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-6mEnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021520Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8mEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022602Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnionEnvironmentalOpen in IMG/M
3300022743Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 2-17_Aug_MGEnvironmentalOpen in IMG/M
3300025336Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025357Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025372Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025379Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025381Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025389Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025392Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025410Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300025411Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025449Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025487Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025606Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025723Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025778Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025779Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun08 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300031759Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003PEnvironmentalOpen in IMG/M
3300031884Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005EnvironmentalOpen in IMG/M
3300032665Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007EnvironmentalOpen in IMG/M
3300032668Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025EnvironmentalOpen in IMG/M
3300032722Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027EnvironmentalOpen in IMG/M
3300032753Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI26470J50227_104353813300003375FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYAGTEGRMPRFVQ*
SLW30_10100653300003650Subglacial FreshwaterMILEDLEYIFAPQIAEGTNKLYFMLKDGNATHIERHAVDDLASLLPMLDSFNYAGTESRIPSFIK*
Ga0007811_1000761103300003787FreshwaterMILEDLEYIFGPQVDEGTTNLYYMLIDGEHRVIERHNATAMARLVPLLDNFQYAGTEAGMPRFTK*
Ga0007811_100198423300003787FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYAGTEGRMPRFVK*
Ga0007811_101879413300003787FreshwaterMILEDLEYIFKPQVDEGTIKLYFMLIDGEHKYIERHPVNDLATLLPMLDSFQYAGTVEHIPRFIK*
Ga0007846_100162813300003797FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQ
Ga0007864_101943123300003806FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTEGRMPRFVQ*
Ga0007877_103321013300003814FreshwaterMILEDLEYIFGPQVDEGTTNLYYMLIDGEHRVIERHNATAMARLVPLLDNFQ
Ga0007856_100610213300003815FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDDNHKVIERHNASDMASLVPMLDNFQY
Ga0069718_1595740913300004481SedimentMILEDLEYIFKPQVDEGTTKLYFMLVDGEHKVMERHDASDIKSLVPMLDSFQYAGKEARIPRFVK*
Ga0007827_1010622123300004777FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTKGRMPRFVQ*
Ga0007796_1009967623300004804FreshwaterMILEDLEYIFKPQVNEGTTKLYFMLVDGEHRVMERHAASDIESLVPMLDSFQYAGIENRIPRFVK*
Ga0078894_1077467933300005662Freshwater LakeMTVEDLVHIFEPQIAEGTTKLYFMLVDGERKFIERHPAHSMNELLPMLDSFQYAGTVQRMPRFVK*
Ga0075466_100577043300006029AqueousMILEDVAHIFKPQIDEGTDKLYFMLIDGEHKMIERHAANDLATLLPLLDAFQYIDTVERIPRFIK*
Ga0075470_1010421723300006030AqueousMILEDVEYIFKPQVNEGTTKLYFMLVDGEHKVMERHNASDIESLVPMLNSFQYAGIENRIPRFVK*
Ga0075465_1001725523300006037AqueousMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHAANDLATLVPLLDAFQYVDTVERIPRFSK*
Ga0007881_102041613300006072FreshwaterFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYAGTEGRMPRFVK*
Ga0007806_101781163300006100FreshwaterEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYAGTEGRMPRFVK
Ga0007813_109508113300006103FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPLLDNFQYAGTEGR
Ga0007862_110528723300006108FreshwaterMILDDLKHIFQPQIDEGTTKLYFMLIDDDHKVIERHPASDLESLVPMLDNFQYHGTEARIPRFVK*
Ga0007848_100986123300006111FreshwaterMMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPLLDNFQYAGTEGRMPRFVQ*
Ga0007857_107025423300006112FreshwaterMILEDLEYIFRPQIDEGTTKLYFMLIDGADLKEVYRHPASDMASLVPLLDNFQYAGTEGRMPRFVQ*
Ga0007818_109761823300006117FreshwaterMILEDLEYIFKPQIDEGTTKMYFMLIDGEHKYIERHPVNDLATLLPMLDSFQYAGTVEHIPRFIK*
Ga0007866_102410723300006119FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDDNHKVIERHNASDMASLVPMLDNFQYAGTEARMPRFVK*
Ga0075471_1062848513300006641AqueousMILEDLEYIFKPQVNEGTTKLYFMLVDGEHKVMERHNASDIESLVPMLDSFQYAGIENRIPRFVK*
Ga0075464_1041612223300006805AqueousMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHDANDLATLLPLLDAFQYSGTVERIPRFSK*
Ga0070748_115976323300006920AqueousMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHDANDLATLVPLLDAFQYIDTVERIPRFIK*
Ga0099851_103559993300007538AqueousMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHDANDLATLLPMLDAFQYIDTVERIPRFSK*
Ga0114344_1005861143300008111Freshwater, PlanktonMILQDLEYIFKPQVDEGTTKLYFMLIDSEHTMMERHNASDIESLVPMLDSFQYAGTEIRIPRFIK*
Ga0114876_123286723300008448Freshwater LakeLEDVEYIFKPQVNEGTTKLYFMLVDGEHKVMERHNASDIGSLVPMLDSFQYAGIENRIPRFVK*
Ga0105105_1030865333300009009Freshwater SedimentMILEDLEHIFKPQIDEGTDSLYFMLVVSDYKLIQRHPADNIDALLPMLDSFQYAGTQDRIPRFTK*
Ga0105098_1046422633300009081Freshwater SedimentMILEDLEYIFKPQIDEGTDSLYFMLVVGEYKLIQRHPSNDMTSLLPMLDSFRYAGTQDRIPRFMQ*
Ga0114962_1000223953300009151Freshwater LakeMILQDLEYIFKPQVDEGTTKLYFMLIDGEHTMMERHNASDIESLVPMLDSFQYAGTEIRIPRFIK*
Ga0114980_10000401373300009152Freshwater LakeMILEDLEYIFKPQIDEGTTILYFMLHDGADSKQICRHSTSDLAGLVPVLDNFQYVGTAGGIPRFKK*
Ga0114978_10009744143300009159Freshwater LakeMILEDLEYIFKPQIDEGTTKLYFMLIDGDTLKEIYRHPASEIASLVLMLDNFQYCGAEGRMPRFIQ*
Ga0105102_1092604323300009165Freshwater SedimentMILEDLEHIFKNQVNEGTDSLYFMLIDGDHKLIQRHPADNIDTLLPMLDSFQYSGTVERLPRFTK*
Ga0114969_1034184013300009181Freshwater LakeMTVEDLVHIFEPQIAEGTTKLYFMLVDGERKFIERHPAHSMNELLPMLDSFQYAGTVQRMPRFV
Ga0114959_1015157213300009182Freshwater LakeQVDEGTTKLYFMLVDGEHKMIERHAASDIESLVPMLDSFQYAGTEIRIPRFVK*
Ga0114959_1022993843300009182Freshwater LakeMTLEDLEYIFQPQIDEGTTELYFTLIDGEHKVIERHPADDLAGLLPMLANFQYHDTVGRFPRFYK*
Ga0114951_1064242223300009502FreshwaterMILEDLQHIFKPQVDEGTDKLYFMLIEDNLKLIHRHPASDMTSLVPMLDNFQYAGTEGRMPRFTK*
Ga0114967_1051304033300010160Freshwater LakeMTVEDLVHIFEPQIAEGTTKLYFMLVDGERKFIERHPAHRMNELLPMLDSFQYAGTVQRM
Ga0136655_113723523300010316Freshwater To Marine Saline GradientMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHDANDLATLVPLLDAFQYSGTVERIPRFSK*
Ga0133913_10073746173300010885Freshwater LakeMILEDLEYIFKPQVDEGTTKLYFMLVDGEHKMIERHAASDIESLVPMLDSFQYAGTEIRIPRFVK*
Ga0133913_1071176153300010885Freshwater LakeMILEDLEYIFKPQIDEGTIKLYFMLIDGDTLKEIYRHPASEIASLVLMLDNFQYCGAEGRMPRFIQ*
Ga0157142_1001433173300012347FreshwaterMILADLEHIFKPQIDEGTDSLYFMLIDGDYKLIQRHPTNDMPSLLPMLDNFQYDGTVERMPRFIQ*
Ga0157497_100218243300012664FreshwaterMILADLEHIFKPQIDEGTDSLYFMLIDGDYKLIQRHPTNDMQSLLPMLDNFQYDGTVERMPRFIQ*
Ga0157210_1000303123300012665FreshwaterMILEDLEYIFKPQVNEGTTKLYFMLVDGEHKVMERHNASDIESLVPMLDSFQYAGTEIRIPRFIK*
Ga0157208_1000695523300012667FreshwaterMILEDLEYIFKPQINEGTTSLYYMLVVGEYKSIQRHPSDDMSSLLPMLDSFQYAGTVERMPRFMQ*
Ga0164296_1016104133300013093FreshwaterMILEDLAHIFGPQVDEGTTNLYYMRIDGEHRVIERHNATAMARLVPLLDNFQYAGTQAGMPRFIK*
Ga0136642_10000162023300013285FreshwaterMIIEDLEYIFKPQLDEGTTKLYFMLIDGEHKLIERHLANDVATLLPMLDSFQYAGTVERIPRFIK*
Ga0136641_1000012773300013286FreshwaterMILEDLEYIFKPQVDEGTTKLYFMLIDGADLKEIYRHPASDMASLVPMLDNFQYAGTEDRMPRFVK*
Ga0211731_1095097463300020205FreshwaterMTVEDLVHIFEPQIAEGTTKLYFMLVDGERKFIERHPAHSMNELLPMLDSFQYAGTVQRMPRFVK
Ga0214194_11116733300020686FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTEGRMPRFVQ
Ga0214246_105342023300020727FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYAGTEGRMPRFVQ
Ga0214206_100638273300021131FreshwaterMQLEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTEGRMPRFVQ
Ga0214164_103351113300021138FreshwaterIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTEGRMPRFVQ
Ga0194052_106928943300021349Anoxic Zone FreshwaterMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHAANDLATLVPLLDAFQYTGTVERIPRFSK
Ga0194048_1014863713300021519Anoxic Zone FreshwaterMIVEDLEYIFKPQIDEGTDKLYFMLIDGEHKMIDRHIANDIATLVPVLDAFQYAGTIERVPRFTK
Ga0194048_1018469133300021519Anoxic Zone FreshwaterMTLDDLEYIFKSQIDEGTDKLYFMLIDGEDKFIQRHAANDISTLLLMLAAFQYTGTQDRIPRFIQ
Ga0194053_1022497613300021520Anoxic Zone FreshwaterMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHAANDLATLVPLLDAFQY
Ga0222713_1054905013300021962Estuarine WaterMILEDVEYIFKPQVNEGTTKLYFMLVDGEHKVMERHNASDIESLVPMLDSFQYAGIENRIPRFVK
Ga0222712_1023548813300021963Estuarine WaterMILEDLEYIFKPQVNEGSTKLYFMLIDGEHKVMERHDASDIESLVPMLDSFQYAGTEIRIPRFVK
Ga0196889_1008804103300022072AqueousMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHAANDLATLLPLLDAFQYIDTVERIPRFIK
Ga0248169_10058043300022602FreshwaterMILEDLEYIFKPQIEEGTSKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTEGRMPRFVQ
Ga0248169_107720193300022602FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPXXXXMASLVPMLDNFQYDGTEGRMPRFVQ
Ga0228699_100680723300022743FreshwaterMILEDLEYIFKPQFEEGTTNLYFMLIDGEYKMIQRHKSTDLETLLPMLDVFQYAGTEARVPRFMK
Ga0208619_11116323300025336FreshwaterMILEDLKYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTKGRMPRFVQ
Ga0208383_1000198123300025357FreshwaterMILDDLKHIFQPQIDEGTTKLYFMLIDDDHKVIERHPASDLESLVPMLDNFQYHGTEARIPRFVK
Ga0208382_101496253300025369FreshwaterMMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPLLDNFQYAGTEGRMPRFVQ
Ga0207957_10000031493300025372FreshwaterMMILEDLEYIFKPQIEEGTTKLYFMLIDDNHKVIERHNASDMASLVPMLDNFQYAGTEARMPRFVK
Ga0208738_1000124173300025379FreshwaterMILDDLKHIFQPQIDEGTTKLYFMLIDNDYKVIERYPASELESLVPMLDNFQYHGTEAKIPRFVK
Ga0208738_100022983300025379FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYAGTEGRMPRFVK
Ga0208738_100079723300025379FreshwaterMILEDLEYIFKPQVDEGTIKLYFMLIDGEHKYIERHPVNDLATLLPMLDSFQYAGTVEHIPRFIK
Ga0208871_101423123300025381FreshwaterEYIFKPQVDEGTIKLYFMLIDGEHKYIERHPVNDLATLLPMLDSFQYAGTVEHIPRFIK
Ga0208257_104499823300025389FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTEARMPRFVK
Ga0208380_104418623300025392FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPLLDNFQYAGTEGRMPRFVQ
Ga0208380_106592713300025392FreshwaterMILEDLEYIFKPQIDEGTTKMYFMLIDGEHKYIERHPVNDLATLLPMLDSFQYAGTVEHIPRFIK
Ga0208875_100493593300025410FreshwaterMILEDLEYIFRPQIDEGTTKLYFMLIDGADLKEVYRHPASDMASLVPLLDNFQYAGTEGRMPRFVQ
Ga0208865_105472513300025411FreshwaterLEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTEGRMPRFVQ
Ga0208106_101533673300025449FreshwaterMILEDLEYIFGPQVDEGTTNLYYMLIDGEHRVIERHNATAMARLVPLLDNFQYA
Ga0208106_102272233300025449FreshwaterMILEDLQYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYAGTEGRMPRFVK
Ga0208106_103888213300025449FreshwaterLEYIFKPQVDEGTIKLYFMLIDGEHKYIERHPVNDLATLLPMLDSFQYAGTVEHIPRFIK
Ga0208426_101195163300025451AqueousMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHAANDLATLVPLLDAFQYVDTVE
Ga0208426_103123033300025451AqueousMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHDANDLATLVPLLDAFQYIDTVERIPRFIK
Ga0208105_103952333300025487FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTKGRMPRFVQ
Ga0207954_110526723300025606FreshwaterMILEDLEYIFKPQVNEGTTKLYFMLVDGEHRVMERHAASDIESLVPMLDSFQYAGIENRIPRFVK
Ga0208643_104476553300025645AqueousMILEDVEHIFKPQIDEGTDKLYFMLIDGEHKMIERHAANDLATLVPLLDAFQYVDTVERIPRFSK
Ga0208741_1009266513300025723FreshwaterMILEDLEYIFKPQIDEGTTKLYFMLIDGEHKLIERHAANDIESLVPMLGSFQYAGTEIRIPRFVK
Ga0208388_106288313300025778FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDDNHKVIERHNASDMASLVPMLDNFQYAGTE
Ga0208869_101129133300025779FreshwaterMILEDLAHIFGPQVDEGTTNLYYMRIDGEHRVIERHNATAMARLVPLLDNFQYAGTQAGMPRFIK
Ga0208916_1017951623300025896AqueousILEDVEHIFKPQIDEGTDKLYFMLIDSEHKMIERHAANDLATLVPLLDAFQYSGTVDRIPRFSK
Ga0209188_10000501043300027708Freshwater LakeMILQDLEYIFKPQVDEGTTKLYFMLIDGEHTMMERHNASDIESLVPMLDSFQYAGTEIRIPRFIK
Ga0209288_1033595123300027762Freshwater SedimentMILEDLEHIFKPQIDEGTDSLYFMLVVSDYKLIQRHPADNIDALLPMLDSFQYAGTQDRIPRFTK
Ga0209500_1001738083300027782Freshwater LakeMILEDLEYIFKPQIDEGTTKLYFMLIDGDTLKEIYRHPASEIASLVLMLDNFQYCGAEGRMPRFIQ
(restricted) Ga0247837_117252723300027970FreshwaterGGLMILEDLEYIFKPQVDEGTTKLYFMLVDGEHKVIERHDASDIKSLVPMLDSFQYAGKEARIPRFVK
Ga0209298_1000528083300027973Freshwater LakeMILEDLEYIFKPQIDEGTTILYFMLHDGADSKQICRHSTSDLAGLVPVLDNFQYVGTAGGIPRFKK
Ga0316219_102345593300031759FreshwaterMILDDLKHIFQPQIDEGTPELYFMLIDDEHKVIERHPASDLESLIPMLDNFQYHGTEARIPRFVK
Ga0316220_104252513300031884FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGAEGRMPRFVQ
Ga0316221_112830733300032665FreshwaterMMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDVTEGRMPRFVQ
Ga0316230_107815553300032668FreshwaterMILDDLKHIFQPQIDEGTPELYFMLIDDEHKVIERHPASDLESLIPMLDNF
Ga0316231_112380313300032722FreshwaterMILEDLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTEGRMPR
Ga0316224_117301943300032753FreshwaterLEYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDTASLVPMLDNFQYAGAEGRMPRFV
Ga0316224_118143143300032753FreshwaterYIFKPQIEEGTTKLYFMLIDGADLKEVYRHPASDMASLVPMLDNFQYDGTEGRMPRFVQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.