NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099400

Metagenome / Metatranscriptome Family F099400

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099400
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 46 residues
Representative Sequence MRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG
Number of Associated Samples 83
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.84 %
% of genes near scaffold ends (potentially truncated) 31.07 %
% of genes from short scaffolds (< 2000 bps) 80.58 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (58.252 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil
(19.417 % of family members)
Environment Ontology (ENVO) Unclassified
(32.039 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.456 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.67%    β-sheet: 0.00%    Coil/Unstructured: 49.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF13676TIR_2 9.71
PF12071DUF3551 8.74
PF04964Flp_Fap 6.80
PF04392ABC_sub_bind 6.80
PF00089Trypsin 3.88
PF07585BBP7 3.88
PF01717Meth_synt_2 2.91
PF03992ABM 1.94
PF01575MaoC_dehydratas 0.97
PF09939DUF2171 0.97
PF01546Peptidase_M20 0.97
PF05050Methyltransf_21 0.97
PF13452MaoC_dehydrat_N 0.97
PF14023DUF4239 0.97
PF00999Na_H_Exchanger 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 6.80
COG3847Flp pilus assembly protein, pilin FlpExtracellular structures [W] 6.80
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 2.91
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.97
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.97
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.97
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.97
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.25 %
UnclassifiedrootN/A41.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y01B390ONot Available561Open in IMG/M
2228664021|ICCgaii200_c0863380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1495Open in IMG/M
3300000156|NODE_c0376811Not Available715Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105443375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1441Open in IMG/M
3300000787|JGI11643J11755_11651895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1095Open in IMG/M
3300003911|JGI25405J52794_10143987Not Available542Open in IMG/M
3300004114|Ga0062593_100435326All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300004114|Ga0062593_101234751All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300004114|Ga0062593_101447939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis737Open in IMG/M
3300004156|Ga0062589_100000503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8997Open in IMG/M
3300004156|Ga0062589_101975597Not Available591Open in IMG/M
3300004157|Ga0062590_100462345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601066Open in IMG/M
3300004479|Ga0062595_100761342Not Available790Open in IMG/M
3300004479|Ga0062595_101836217All Organisms → cellular organisms → Bacteria → Proteobacteria577Open in IMG/M
3300004479|Ga0062595_102437540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283520Open in IMG/M
3300004480|Ga0062592_100260250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1280Open in IMG/M
3300004480|Ga0062592_100657743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283903Open in IMG/M
3300004643|Ga0062591_102084606All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300005162|Ga0066814_10004313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1459Open in IMG/M
3300005164|Ga0066815_10014474All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831026Open in IMG/M
3300005295|Ga0065707_10090502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae4107Open in IMG/M
3300005329|Ga0070683_101561012Not Available635Open in IMG/M
3300005332|Ga0066388_108030230Not Available527Open in IMG/M
3300005336|Ga0070680_100556501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis983Open in IMG/M
3300005339|Ga0070660_101250248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales630Open in IMG/M
3300005353|Ga0070669_100054600All Organisms → cellular organisms → Bacteria → Proteobacteria2926Open in IMG/M
3300005367|Ga0070667_100063040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3141Open in IMG/M
3300005406|Ga0070703_10005498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3546Open in IMG/M
3300005530|Ga0070679_101916533Not Available541Open in IMG/M
3300005713|Ga0066905_100170966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1591Open in IMG/M
3300005713|Ga0066905_100986071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium742Open in IMG/M
3300005764|Ga0066903_100718778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1766Open in IMG/M
3300006353|Ga0075370_10068287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2030Open in IMG/M
3300006605|Ga0074057_12143706Not Available850Open in IMG/M
3300006806|Ga0079220_10809044Not Available710Open in IMG/M
3300006806|Ga0079220_11153230Not Available634Open in IMG/M
3300006852|Ga0075433_10373456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1259Open in IMG/M
3300006954|Ga0079219_11381034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales627Open in IMG/M
3300007076|Ga0075435_102044619Not Available503Open in IMG/M
3300009092|Ga0105250_10529856Not Available538Open in IMG/M
3300009094|Ga0111539_10026368All Organisms → cellular organisms → Bacteria7106Open in IMG/M
3300009101|Ga0105247_10073698All Organisms → cellular organisms → Bacteria → Proteobacteria2140Open in IMG/M
3300009147|Ga0114129_13383174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens513Open in IMG/M
3300010359|Ga0126376_12943169Not Available526Open in IMG/M
3300010362|Ga0126377_10037813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4131Open in IMG/M
3300010362|Ga0126377_10542829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1200Open in IMG/M
3300010371|Ga0134125_10097364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3275Open in IMG/M
3300010371|Ga0134125_11134078Not Available855Open in IMG/M
3300010373|Ga0134128_11878140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales659Open in IMG/M
3300010375|Ga0105239_12604517Not Available590Open in IMG/M
3300010399|Ga0134127_10436910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1304Open in IMG/M
3300010399|Ga0134127_10726996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831035Open in IMG/M
3300010401|Ga0134121_12710785Not Available541Open in IMG/M
3300012496|Ga0157353_1040002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283535Open in IMG/M
3300012515|Ga0157338_1003649All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831289Open in IMG/M
3300012891|Ga0157305_10247881Not Available534Open in IMG/M
3300012943|Ga0164241_10717695Not Available726Open in IMG/M
3300012986|Ga0164304_11569031Not Available547Open in IMG/M
3300014497|Ga0182008_10028754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2811Open in IMG/M
3300015371|Ga0132258_10482218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3097Open in IMG/M
3300015371|Ga0132258_11086635Not Available2022Open in IMG/M
3300015372|Ga0132256_100644061Not Available1175Open in IMG/M
3300015372|Ga0132256_101793788All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300015373|Ga0132257_101123681Not Available992Open in IMG/M
3300015373|Ga0132257_102062849All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300015374|Ga0132255_100539460Not Available1718Open in IMG/M
3300015374|Ga0132255_103335626Not Available684Open in IMG/M
3300019356|Ga0173481_10001207All Organisms → cellular organisms → Bacteria6141Open in IMG/M
3300019356|Ga0173481_10003010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4325Open in IMG/M
3300022737|Ga0247747_1034582Not Available598Open in IMG/M
3300022880|Ga0247792_1025273Not Available1012Open in IMG/M
3300023073|Ga0247744_1077859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283572Open in IMG/M
3300025900|Ga0207710_10425891Not Available683Open in IMG/M
3300025907|Ga0207645_10555700Not Available779Open in IMG/M
3300025917|Ga0207660_10320761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1237Open in IMG/M
3300025917|Ga0207660_10582553Not Available911Open in IMG/M
3300025921|Ga0207652_11628125Not Available550Open in IMG/M
3300025941|Ga0207711_10048879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3619Open in IMG/M
3300025941|Ga0207711_11670679Not Available580Open in IMG/M
3300026035|Ga0207703_10072075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2855Open in IMG/M
3300026758|Ga0207559_102225Not Available728Open in IMG/M
3300026759|Ga0207527_100727Not Available979Open in IMG/M
3300026764|Ga0207470_100048All Organisms → cellular organisms → Bacteria1728Open in IMG/M
3300027122|Ga0207538_1003979Not Available790Open in IMG/M
3300027400|Ga0207560_106382Not Available514Open in IMG/M
3300027425|Ga0207522_100597Not Available937Open in IMG/M
3300027447|Ga0207622_100145All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300027560|Ga0207981_1016917All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300027765|Ga0209073_10470011Not Available526Open in IMG/M
3300027876|Ga0209974_10100952Not Available1008Open in IMG/M
(restricted) 3300031150|Ga0255311_1012403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1719Open in IMG/M
(restricted) 3300031150|Ga0255311_1058820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283812Open in IMG/M
(restricted) 3300031197|Ga0255310_10133900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0283676Open in IMG/M
3300031716|Ga0310813_10012406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5555Open in IMG/M
3300031716|Ga0310813_11918048Not Available558Open in IMG/M
3300031820|Ga0307473_10937071Not Available628Open in IMG/M
3300032000|Ga0310903_10145462All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300032013|Ga0310906_10967345Not Available610Open in IMG/M
3300032179|Ga0310889_10101671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831224Open in IMG/M
3300032180|Ga0307471_100639749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1225Open in IMG/M
3300033475|Ga0310811_10007559All Organisms → cellular organisms → Bacteria → Proteobacteria13944Open in IMG/M
3300034692|Ga0373917_0005777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1373Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil19.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere5.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.91%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil2.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.94%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.97%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.97%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.97%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.97%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300023073Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026751Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026758Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026759Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026764Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027122Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027400Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027425Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027447Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G08K4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034692Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
4MG_012998702170459019Switchgrass, Maize And Mischanthus LitterMRKLTWIIGLLALGASLDSSLYDGAYTRALVNAIQDMHTAIGLK
ICCgaii200_086338032228664021SoilMRKFTWIIGLLALGAALDSSLYDGAYTRAFVYMIQDAHRSIGLK
NODE_037681133300000156Sugar Cane Bagasse Incubating BioreactorMRAFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGLR*
INPhiseqgaiiFebDRAFT_10544337513300000364SoilMRMAVWIVGLLALATSLDTSLYDGAYTRAFVGMIRDLYAAIGLNRIG*
JGI11643J11755_1165189533300000787SoilMRKFTWIIGLLALGAALDSSLYDGAYTRAFVYMIQDAHRSIGLK*
JGI25405J52794_1014398713300003911Tabebuia Heterophylla RhizosphereMRIAVWIVGLLALATSLDTSLYDGAYTRAFVGMIRDLYAAIGLNRIG*
Ga0062593_10043532623300004114SoilMRMLTWIVGLLALGASLDSSLWDGAYTRAFVTMIHDLHTAIGLNLTR*
Ga0062593_10123475123300004114SoilMRMLTWIIGLLALGASLDSSLYDGAYTRALVNTIQDMHTAIGLKLTG*
Ga0062593_10144793933300004114SoilLAPMRKFTWIIGLLALGAALDSSLYDGAYTRALVYMIQDAHTAIGLR*
Ga0062589_10000050323300004156SoilMRMLIWIVGLLALGASLDSSLYDGAYTRALVGKIQDTHTAIGLK*
Ga0062589_10197559713300004156SoilAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG*
Ga0062590_10046234513300004157SoilMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG*
Ga0062595_10076134223300004479SoilMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG*
Ga0062595_10183621713300004479SoilMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKLTG*
Ga0062595_10243754013300004479SoilIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG*
Ga0062592_10026025043300004480SoilMRKFTWIIGLLALGAALDSSLYDGAYTRALVYMIQDAHTAIGLR*
Ga0062592_10065774313300004480SoilMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG*
Ga0062591_10208460623300004643SoilWIIGLLALGASLDSSLYDGAYTRALVNTIQDMHTAIGLKLTG*
Ga0066814_1000431323300005162SoilMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKTFGLNLPG*
Ga0066815_1001447413300005164SoilKNCSASLLLMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG*
Ga0065707_1009050243300005295Switchgrass RhizosphereMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG*
Ga0070683_10156101223300005329Corn RhizosphereLSGIIVAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG*
Ga0066388_10803023023300005332Tropical Forest SoilMRIAVWIVGLLALATSLDTSLYDGAYTRAFVGMIGNLYTAIGLNRIG*
Ga0070680_10055650133300005336Corn RhizosphereMRKFTWIIGLLALGAALDSSLYDGAYTRALVYMIQDAHTAIGLK*
Ga0070660_10125024823300005339Corn RhizosphereMRAFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGFK*
Ga0070669_10005460043300005353Switchgrass RhizosphereLLLMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG*
Ga0070667_10006304043300005367Switchgrass RhizosphereMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG*
Ga0070703_1000549843300005406Corn, Switchgrass And Miscanthus RhizosphereLLLMRMLIWIVGLLALATPLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG*
Ga0070679_10191653323300005530Corn RhizosphereMRAFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGLK*
Ga0066905_10017096623300005713Tropical Forest SoilMRIAVWIVGLLALATSLDTSLYDGAYTRAFVGMIGSLYTAIGLNRIG*
Ga0066905_10098607113300005713Tropical Forest SoilMRKAVWIVGLLALATSLDTSLYDGAYTRAFVGMIGSLYTAIGLNRIG*
Ga0066903_10071877833300005764Tropical Forest SoilMRMAVWIVGLLALASTLDTSLNDGAYTRALAGMIQDLYAALGLNRIG*
Ga0075370_1006828753300006353Populus EndosphereAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG*
Ga0074057_1214370623300006605SoilMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKTFGLNLPG
Ga0079220_1080904413300006806Agricultural SoilMRPLIWIIGLLALATSLDSSLNDGIYTRAFVGMIQDLNAAFGLNRIG*
Ga0079220_1115323023300006806Agricultural SoilMRMAVWIVGLLALATSLDSSLNGGEYTRAFVSMIQDIPSSIGLQRIS*
Ga0075433_1037345623300006852Populus RhizosphereMRMAVWIIGLLALATSLDSSLNDGIYTRAFVSMIQDLHTALGLNRIG*
Ga0079219_1138103413300006954Agricultural SoilTIEAHLCAMRAFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGLR*
Ga0075435_10204461923300007076Populus RhizosphereMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQD
Ga0105250_1052985613300009092Switchgrass RhizosphereMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLN
Ga0111539_1002636873300009094Populus RhizosphereMRMLVWIVGLLALATSLDASLNDGIYTRAFVSMIQDFPATVGLNRIG*
Ga0105247_1007369843300009101Switchgrass RhizosphereLSGIIAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG*
Ga0114129_1338317413300009147Populus RhizosphereMRMLVWIVGLLALATSLDASLNDGIYTRAFVSMIQD
Ga0126376_1294316923300010359Tropical Forest SoilMAVWIVGLLALASTLDTSLNDGAYTRALAGMIQDLYAALGLNRIG*
Ga0126377_1003781333300010362Tropical Forest SoilMRMAVWIVGLLALASTLDTSLNDGAYTRALVGMIQDLHTALGLNRIG*
Ga0126377_1054282923300010362Tropical Forest SoilMRMAVWIVGLLALATSLDTSLYDGAYTRAFVGMIADLYIALGLNRIG*
Ga0134125_1009736443300010371Terrestrial SoilMFIWIVGLLALATSLDSSLNDGAYTRAFVGLIQDLNAAFGLNRIG*
Ga0134125_1113407823300010371Terrestrial SoilMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTSIQDMHRAFGLHLFG*
Ga0134128_1187814033300010373Terrestrial SoilFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGLK*
Ga0105239_1260451713300010375Corn RhizosphereMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAF
Ga0134127_1043691033300010399Terrestrial SoilLSGILAPMRKFTWIIGLLALGAALDSSLYDGAYTRALVYMIQDAHTAIGLK*
Ga0134127_1072699623300010399Terrestrial SoilMRMLIWIVGLLALATSLDSSLYGGAYTRVFVAMIQDMHKAFGLNLPG*
Ga0134121_1271078513300010401Terrestrial SoilLSGILAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG*
Ga0157353_104000213300012496Unplanted SoilLLMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG*
Ga0157338_100364923300012515Arabidopsis RhizosphereVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG*
Ga0157305_1024788113300012891SoilMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLSLPG*
Ga0164241_1071769523300012943SoilMRMLIWIVGLLALGASLDASLWDGAYTRALVGVIQDTHTAIGLK*
Ga0164304_1156903113300012986SoilMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNL
Ga0182008_1002875453300014497RhizosphereMRVFTWFVALLALCASLDTSLYDGAYTRALVGMVNDAHNAIGLR*
Ga0132258_1048221833300015371Arabidopsis RhizosphereMRMLIWIVGLLALGTSLDSSLYGGAYTRAFVSIIQDTHTAIGLK*
Ga0132258_1108663533300015371Arabidopsis RhizosphereMAVWIVGLLALASTLDTSLNDGAYTRALAGMIQDLYTALGLNRIG*
Ga0132256_10064406133300015372Arabidopsis RhizosphereLSGILAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQEMHTAIGLKITG*
Ga0132256_10179378823300015372Arabidopsis RhizosphereMRILTWIIGLLALGASLDSSLYDGAYTRALVNTIQDMHTAIGLKLTG*
Ga0132257_10112368133300015373Arabidopsis RhizosphereMRMLTWIVGLLALGASLDSSLYDGAYTRALVNTIQDMHTAIGLKLTG*
Ga0132257_10206284923300015373Arabidopsis RhizosphereMRMLIWIVGLLVLGTSLDSSLYGGAYTRAFVSIIQDTHTAIGLK*
Ga0132255_10053946053300015374Arabidopsis RhizosphereMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQD
Ga0132255_10333562623300015374Arabidopsis RhizosphereLSGIIAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQEMHTAIGLKITG*
Ga0173481_1000120763300019356SoilMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG
Ga0173481_1000301043300019356SoilMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG
Ga0247747_103458213300022737SoilMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLP
Ga0247792_102527313300022880SoilMRILIWIVGLLALGTSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG
Ga0247744_107785913300023073SoilSASLLLMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG
Ga0207710_1042589113300025900Switchgrass RhizosphereMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG
Ga0207645_1055570013300025907Miscanthus RhizosphereMRMLTWIIGLLALGASLDSSLYDGAYTRALVNTIQDM
Ga0207660_1032076123300025917Corn RhizosphereMRKFTWIIGLLALGAALDSSLYDGAYTRALVYMIQDAHTAIGLK
Ga0207660_1058255323300025917Corn RhizosphereMRMLIWIVGLLALGASLDSSLYDGAYTRALVGKIQDTHTAIGLK
Ga0207652_1162812523300025921Corn RhizosphereMRAFTWFVALLALCASLDTSLYDGAYTRALVSMVNDAHNAIGLK
Ga0207711_1004887993300025941Switchgrass RhizosphereLSGIIAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG
Ga0207711_1167067913300025941Switchgrass RhizosphereLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG
Ga0207703_1007207563300026035Switchgrass RhizosphereIIAAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG
Ga0207594_10008613300026751SoilSLTIVRHPCPMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG
Ga0207559_10222523300026758SoilMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMH
Ga0207527_10072723300026759SoilMRILIWIVGLLALGTSLDSSLYDGAYTRALVGKIQDTHTAIGLK
Ga0207470_10004813300026764SoilLTIVRHPCPMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG
Ga0207538_100397913300027122SoilRHPCPMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG
Ga0207560_10638213300027400SoilMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRA
Ga0207522_10059713300027425SoilIWIVGLLALGTSLDSSLYGGAYTRAFVTTIQDMHRAFGLHLFG
Ga0207622_10014513300027447SoilPMRILIWIVGLLALGTSLVSSLRGGAYTRAFVTMIQDMHRAFGLHLFG
Ga0207981_101691723300027560SoilMRMLIWIVGLLVLGTSLDSSLYGGAYTQAFVSMIQDTHAAIGLK
Ga0209073_1047001123300027765Agricultural SoilMRMAVWIVGLLALATSLDSSLNGGEYTRAFVSMIQDIPSSIGLQRIS
Ga0209974_1010095213300027876Arabidopsis Thaliana RhizosphereMRRLTWIIGLLALGASLDSSLYDGAYTRALVNMIQDMHTAIGLKLTG
(restricted) Ga0255311_101240343300031150Sandy SoilLFGILGPMRKFTWIIGLLALGAALDSSLYDGAYTRAFVYMIQDAHRAVGLK
(restricted) Ga0255311_105882013300031150Sandy SoilLIWIVGLLALATSLDSSLYGGAYTRAFVATIQDMRKAFGLNLPG
(restricted) Ga0255310_1013390013300031197Sandy SoilKNRPASLLLMRMLIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG
Ga0310813_1001240643300031716SoilMRKLTWIIGLLALGASLDSSLYDGAYTRALVNTIQDMHRAIGLK
Ga0310813_1191804813300031716SoilMRMLTWIIGLLALAASLDSSLYDGAYARAFVNAIQDMHTAIGLKMTG
Ga0307473_1093707123300031820Hardwood Forest SoilMRILIWIVGLLALGTSLDSSLYGGAYTRAFVTSIQDMHRAFGLHLFG
Ga0310903_1014546233300032000SoilMRMLIWIVGLLVLGTSLDSSLYGGAYTRAFVSMIQDTHTAIGLK
Ga0310906_1096734523300032013SoilMRMLIWIVGLLALGTSLDSSLYGGAYTRAFVSMIQDTHTAIGLK
Ga0310889_1010167113300032179SoilIWIVGLLALATSLDSSLYGGAYTRAFVAMIQDMHKAFGLNLPG
Ga0307471_10063974913300032180Hardwood Forest SoilMRIAVWIVGLLALATSLDTSLYDGAYTRAFVGMIRDLYAAIGLNRIG
Ga0310811_10007559193300033475SoilLSGIIVAMRMLTWIIGLLALAASLDSSLYDGAYTRAFVNAIQDMHTAIGLKMTG
Ga0373917_0005777_915_10493300034692Sediment SlurryMRKFTWIIGLLALGAALDSSLYDGAYTRAFVYLIQDAHRAVGLK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.