Basic Information | |
---|---|
Family ID | F101101 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 42 residues |
Representative Sequence | MFERFTDKARTAVILAKAKAAERGDQIRPVYLLHALASGEG |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 97.06 % |
% of genes from short scaffolds (< 2000 bps) | 92.16 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (52.941 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.372 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.412 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.196 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF08281 | Sigma70_r4_2 | 36.27 |
PF08279 | HTH_11 | 26.47 |
PF13384 | HTH_23 | 17.65 |
PF08022 | FAD_binding_8 | 5.88 |
PF01794 | Ferric_reduct | 2.94 |
PF02861 | Clp_N | 0.98 |
PF04205 | FMN_bind | 0.98 |
PF02424 | ApbE | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.94 % |
Unclassified | root | N/A | 47.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZRSKLJ02JXJDV | Not Available | 503 | Open in IMG/M |
3300001653|JGI20275J16321_100571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 761 | Open in IMG/M |
3300001686|C688J18823_10549252 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300005436|Ga0070713_100533113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1110 | Open in IMG/M |
3300005451|Ga0066681_10181476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1252 | Open in IMG/M |
3300005455|Ga0070663_101421566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
3300005471|Ga0070698_101979394 | Not Available | 536 | Open in IMG/M |
3300005529|Ga0070741_11371237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
3300005530|Ga0070679_100878892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
3300005618|Ga0068864_101755315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 626 | Open in IMG/M |
3300005834|Ga0068851_10512541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 721 | Open in IMG/M |
3300006102|Ga0075015_101040824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 503 | Open in IMG/M |
3300006581|Ga0074048_13070691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
3300006603|Ga0074064_10006380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 686 | Open in IMG/M |
3300006806|Ga0079220_10417697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 883 | Open in IMG/M |
3300009101|Ga0105247_11848386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
3300009174|Ga0105241_10198721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1673 | Open in IMG/M |
3300009520|Ga0116214_1282341 | Not Available | 634 | Open in IMG/M |
3300009553|Ga0105249_10145571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2276 | Open in IMG/M |
3300009700|Ga0116217_10416974 | Not Available | 850 | Open in IMG/M |
3300010322|Ga0134084_10385900 | Not Available | 543 | Open in IMG/M |
3300010333|Ga0134080_10509709 | Not Available | 573 | Open in IMG/M |
3300010371|Ga0134125_10600578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1216 | Open in IMG/M |
3300010396|Ga0134126_12059570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
3300010880|Ga0126350_10163506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2376 | Open in IMG/M |
3300011270|Ga0137391_10554408 | Not Available | 968 | Open in IMG/M |
3300012210|Ga0137378_10524083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
3300012351|Ga0137386_10770192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
3300012498|Ga0157345_1039878 | Not Available | 561 | Open in IMG/M |
3300012923|Ga0137359_10352488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1308 | Open in IMG/M |
3300012987|Ga0164307_11861255 | Not Available | 510 | Open in IMG/M |
3300013104|Ga0157370_10711606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
3300013104|Ga0157370_10784587 | Not Available | 867 | Open in IMG/M |
3300014969|Ga0157376_10854476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
3300015357|Ga0134072_10362270 | Not Available | 560 | Open in IMG/M |
3300016341|Ga0182035_11301537 | Not Available | 651 | Open in IMG/M |
3300017926|Ga0187807_1024509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1862 | Open in IMG/M |
3300017930|Ga0187825_10141546 | Not Available | 847 | Open in IMG/M |
3300017961|Ga0187778_11353579 | Not Available | 502 | Open in IMG/M |
3300017974|Ga0187777_10334167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1040 | Open in IMG/M |
3300017974|Ga0187777_11120208 | Not Available | 573 | Open in IMG/M |
3300017993|Ga0187823_10344671 | Not Available | 529 | Open in IMG/M |
3300018090|Ga0187770_10612251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
3300021046|Ga0215015_10876893 | Not Available | 619 | Open in IMG/M |
3300021402|Ga0210385_10896706 | Not Available | 681 | Open in IMG/M |
3300021405|Ga0210387_11001092 | Not Available | 732 | Open in IMG/M |
3300021407|Ga0210383_10863210 | Not Available | 772 | Open in IMG/M |
3300021474|Ga0210390_10063278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3051 | Open in IMG/M |
3300021478|Ga0210402_10771129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. P27 | 886 | Open in IMG/M |
3300021559|Ga0210409_10749500 | Not Available | 848 | Open in IMG/M |
3300021559|Ga0210409_11181698 | Not Available | 640 | Open in IMG/M |
3300022873|Ga0224550_1057104 | Not Available | 560 | Open in IMG/M |
3300025412|Ga0208194_1055885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
3300025911|Ga0207654_11238801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
3300025929|Ga0207664_10930160 | Not Available | 780 | Open in IMG/M |
3300026088|Ga0207641_11475608 | Not Available | 681 | Open in IMG/M |
3300026318|Ga0209471_1087710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1364 | Open in IMG/M |
3300026523|Ga0209808_1264559 | Not Available | 549 | Open in IMG/M |
3300027297|Ga0208241_1057000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix espanaensis → Saccharothrix espanaensis DSM 44229 | 622 | Open in IMG/M |
3300027684|Ga0209626_1108061 | Not Available | 723 | Open in IMG/M |
3300027889|Ga0209380_10516530 | Not Available | 696 | Open in IMG/M |
3300030007|Ga0311338_10468513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
3300030739|Ga0302311_10240000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1348 | Open in IMG/M |
3300030880|Ga0265776_110106 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 556 | Open in IMG/M |
3300030940|Ga0265740_1042875 | Not Available | 538 | Open in IMG/M |
3300031446|Ga0170820_10575365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
3300031543|Ga0318516_10661220 | Not Available | 594 | Open in IMG/M |
3300031544|Ga0318534_10388382 | Not Available | 802 | Open in IMG/M |
3300031546|Ga0318538_10244108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
3300031573|Ga0310915_10215526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
3300031679|Ga0318561_10420329 | Not Available | 735 | Open in IMG/M |
3300031708|Ga0310686_106655887 | Not Available | 922 | Open in IMG/M |
3300031719|Ga0306917_10086662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2214 | Open in IMG/M |
3300031765|Ga0318554_10321293 | Not Available | 880 | Open in IMG/M |
3300031765|Ga0318554_10510673 | Not Available | 680 | Open in IMG/M |
3300031768|Ga0318509_10075174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1780 | Open in IMG/M |
3300031769|Ga0318526_10276583 | Not Available | 687 | Open in IMG/M |
3300031781|Ga0318547_10065318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2001 | Open in IMG/M |
3300031793|Ga0318548_10250691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
3300031794|Ga0318503_10144107 | Not Available | 767 | Open in IMG/M |
3300031795|Ga0318557_10211717 | Not Available | 885 | Open in IMG/M |
3300031831|Ga0318564_10016114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3048 | Open in IMG/M |
3300031835|Ga0318517_10313643 | Not Available | 709 | Open in IMG/M |
3300031845|Ga0318511_10241087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. P27 | 810 | Open in IMG/M |
3300031845|Ga0318511_10309746 | Not Available | 715 | Open in IMG/M |
3300031879|Ga0306919_10981638 | Not Available | 646 | Open in IMG/M |
3300031896|Ga0318551_10776566 | Not Available | 556 | Open in IMG/M |
3300032008|Ga0318562_10166245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1273 | Open in IMG/M |
3300032008|Ga0318562_10670204 | Not Available | 597 | Open in IMG/M |
3300032041|Ga0318549_10040526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1885 | Open in IMG/M |
3300032041|Ga0318549_10529412 | Not Available | 529 | Open in IMG/M |
3300032065|Ga0318513_10554527 | Not Available | 562 | Open in IMG/M |
3300032174|Ga0307470_10821879 | Not Available | 722 | Open in IMG/M |
3300032180|Ga0307471_102304019 | Not Available | 679 | Open in IMG/M |
3300032261|Ga0306920_101931351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. P27 | 829 | Open in IMG/M |
3300032261|Ga0306920_101959151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
3300032770|Ga0335085_11342868 | Not Available | 752 | Open in IMG/M |
3300032783|Ga0335079_10147746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2639 | Open in IMG/M |
3300032895|Ga0335074_10697121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
3300033289|Ga0310914_10399504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1244 | Open in IMG/M |
3300033289|Ga0310914_11424835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. P27 | 596 | Open in IMG/M |
3300033412|Ga0310810_10166297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2542 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.90% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.98% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.98% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300001653 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_08703320 | 2170459024 | Grass Soil | MFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALASGDGVAARALAG |
JGI20275J16321_1005713 | 3300001653 | Forest Soil | MFERFTDKARKVVILAKGKATERGDDQIRPVHMLYGLAAADGVAAR |
C688J18823_105492523 | 3300001686 | Soil | MFERFTDKARAAVIQARATAAGRGDRMIRPAYLLYAL |
Ga0070713_1005331131 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MFERFTDKARTAVIVARAEASERGDQIRPVYLLHALAAGEGVAARALAG |
Ga0066681_101814763 | 3300005451 | Soil | MFERFTDKARTAVIAARAEASERGDQIRPEYLLHALAAGEGVAA |
Ga0070663_1014215661 | 3300005455 | Corn Rhizosphere | MFERLTDRARAAVIQARATAAERGDQIRPVYLLHAVALGEGTAARALAGLGID |
Ga0070698_1019793942 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MFERFTDKARKVVVVVVVLAKGKATERGDDQIRPVHMLYGLAA |
Ga0070741_113712371 | 3300005529 | Surface Soil | MFERFTDRARAAVIRARATAAERGDQIRPVYLLHAVALGEGTAARALAGLGIDAG |
Ga0070679_1008788923 | 3300005530 | Corn Rhizosphere | MFERFTDRARAAVIRARATAAERGDQIRPVYLLHAVALGE |
Ga0068864_1017553153 | 3300005618 | Switchgrass Rhizosphere | MFERLTDRARAAVIQARATAAERGDQIRPVYLLHAVALGEGTA |
Ga0068851_105125413 | 3300005834 | Corn Rhizosphere | MFERFTDKAKTAVIAARAEAAERGDQIRPVYLLHALAS |
Ga0075015_1010408241 | 3300006102 | Watersheds | MFERFTDKARTVVILAKAKATERGDQIRPVYMLYALASAEGVAA |
Ga0074048_130706912 | 3300006581 | Soil | MFERFTDRARTAVILARTEASERGDQIRPVYMLHAL |
Ga0074064_100063801 | 3300006603 | Soil | MFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALA |
Ga0079220_104176973 | 3300006806 | Agricultural Soil | MFERFTDKARAAVIVARAEASERGDQIRPVYLLHALAAGEGVA |
Ga0105247_118483861 | 3300009101 | Switchgrass Rhizosphere | MFERFTDRARAAVIRARATAAERGDQIRPVYLLHAVALGEGTAARALAGLGID |
Ga0105241_101987211 | 3300009174 | Corn Rhizosphere | MFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALASGDGV |
Ga0116214_12823411 | 3300009520 | Peatlands Soil | MFERFTDKARKVVILAKHKATEQGDAEIRPVHMLY |
Ga0105249_101455711 | 3300009553 | Switchgrass Rhizosphere | MFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALAAGDGVAARA |
Ga0116217_104169741 | 3300009700 | Peatlands Soil | MFERFTDKARTVVILAKAKATERGDQIRPVYMLYA |
Ga0134084_103859001 | 3300010322 | Grasslands Soil | MFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALAA |
Ga0134080_105097092 | 3300010333 | Grasslands Soil | MFERFTDKAKTAVILAKADASERGDQIRPVYLLHALAAG |
Ga0134125_106005783 | 3300010371 | Terrestrial Soil | MFERFTDKARTAVIVARAEASERSDQIRPVYLLHALAA |
Ga0134126_120595702 | 3300010396 | Terrestrial Soil | MFERLTDRARAAVIRARATAAERGDQIRPVYLLHAVA |
Ga0126350_101635061 | 3300010880 | Boreal Forest Soil | MFERFTDKARKVVLLAKGKATERGDDQIRPVHLLYGLAAADG |
Ga0137391_105544082 | 3300011270 | Vadose Zone Soil | MFERFTDKARTAVILAKAKAAERGDQIRPVYLLHALASGEG* |
Ga0137378_105240831 | 3300012210 | Vadose Zone Soil | MFERFTDKARTVVILAKAKATERGDQIRPVYMLHA |
Ga0137386_107701922 | 3300012351 | Vadose Zone Soil | MFERFTDKARKVVILAKAKATERGDQIRPVYMLHALASGEGVAARVLA |
Ga0157345_10398782 | 3300012498 | Arabidopsis Rhizosphere | MFERFTDRARTAVILARTEASERGDQIRPVYMLHALA |
Ga0137359_103524883 | 3300012923 | Vadose Zone Soil | MFERFTDKARTVVILAKARAAERGDQIRPVYMLHALAAGDGVAARALAGPQ |
Ga0164307_118612552 | 3300012987 | Soil | MFERFTDRARTVMILARTTAAARGDQIRPVYLLHALT |
Ga0157370_107116063 | 3300013104 | Corn Rhizosphere | MFERFTDKAKTAVIAARAEAAERGDQIRPVYLLHALASGDGVAARALAGL |
Ga0157370_107845873 | 3300013104 | Corn Rhizosphere | MFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALASGDGVAARALAGL |
Ga0157376_108544763 | 3300014969 | Miscanthus Rhizosphere | MFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALACGDGVAARA |
Ga0134072_103622702 | 3300015357 | Grasslands Soil | MFERFTDKARTAVIAARAEAAERGDQIRPVYLLHALASGDGVAAR |
Ga0182035_113015371 | 3300016341 | Soil | MFERFTDQARSAVSLARAKAAERGDQIRPVYMLYALTCGDGVAARALAGL |
Ga0187807_10245092 | 3300017926 | Freshwater Sediment | MFERFTDKARKIVILAKAKATERGDDQIRPVHMLYGWPPPTAWPPGR |
Ga0187825_101415462 | 3300017930 | Freshwater Sediment | MFERFTDKARKVVSLALAKAKEQGDDQVRPVHMLYGVTAADGVAARAL |
Ga0187778_113535792 | 3300017961 | Tropical Peatland | MFERFTDKARKVVVVAKTAATERGEDQVRPLHMLYGLAATDGVAA |
Ga0187777_103341673 | 3300017974 | Tropical Peatland | MFERFTDKARSAVILAKTKATERGDDQIRPLHMLYGLVA |
Ga0187777_111202082 | 3300017974 | Tropical Peatland | MFERFTDKARTVVILAKTKATERGDDQIRPEHMLY |
Ga0187823_103446712 | 3300017993 | Freshwater Sediment | MFERFTDRARTAVILARTEASERGDQIRPEYMLHALAADEGVA |
Ga0187770_106122511 | 3300018090 | Tropical Peatland | MFERFTDKARKVVILAKTKATERGDDQIRPVHMLYGLVSTDGMA |
Ga0215015_108768931 | 3300021046 | Soil | MFERFSDQARTVVILAKAKATERGDQIRPVYGLDTGNGQWR |
Ga0210385_108967061 | 3300021402 | Soil | MFERFTDKARKVVILAKTKATDRGDDQIGPVHMLYGL |
Ga0210387_110010921 | 3300021405 | Soil | MFERFTDRARTAVILARTEASERGDQIRPEYMLHA |
Ga0210383_108632102 | 3300021407 | Soil | MFERFTDKARKVVFLAKGKATERGDDQIRPVHMLYGLAA |
Ga0210390_100632781 | 3300021474 | Soil | MFERFTDKARKVVILAKGKATERGDDQIRPVHMLYGLAAADGVA |
Ga0210402_107711291 | 3300021478 | Soil | MFERFTGNARTVVILAKAKATERGDQIRPVYMLYALASAEGVAARALA |
Ga0210409_107495001 | 3300021559 | Soil | MFERFTDKARKVVFLAKGKATERGDDQIRPVHMLY |
Ga0210409_111816982 | 3300021559 | Soil | MFERFTDKARTAVIAARAEASERGDQIRPVYLLHALAAGQG |
Ga0224550_10571041 | 3300022873 | Soil | MFERFTDKARQVVFLAKGKATERDDDQIRPVHMLYGLAAADGVAARVLT |
Ga0208194_10558851 | 3300025412 | Peatland | MFERFTDNARAAVFTARAKAAERGDQIRPLYLLYALAAGEGVAARTLAGLAVDAA |
Ga0207654_112388011 | 3300025911 | Corn Rhizosphere | MFERFTDRARAAVIRARATAAERGDQIRPVYLLHAVALGEGTAAR |
Ga0207664_109301601 | 3300025929 | Agricultural Soil | MFERFTDKARTAVIAARAEAAERGDQIRPVYLLHAL |
Ga0207641_114756081 | 3300026088 | Switchgrass Rhizosphere | MFERFTDKAKTAVIAARAEAAERGDQIRPVYLLHALASGDGVAARALAG |
Ga0209471_10877104 | 3300026318 | Soil | MFERFTDKARTAVIVARADASERGDQIRPVYLLHAL |
Ga0209808_12645592 | 3300026523 | Soil | MFERFTDKARTAVIVAKAEASERGDQIRPVYLLHAL |
Ga0208241_10570001 | 3300027297 | Forest Soil | MFERFTDRARKVVSLALNKAKERGDDQIRPVHMLYGV |
Ga0209626_11080613 | 3300027684 | Forest Soil | MFERFTDKARTVVILARAKATERGDQIRPVYMLYALASAEG |
Ga0209380_105165301 | 3300027889 | Soil | MFERFTDKARKVVVLAKNKATERGDDQIRPVHMLYGLV |
Ga0311338_104685133 | 3300030007 | Palsa | MFERFTDKARGTVFAARAKAAERGDGQIRPVYMLHGLITMDGVAARALAGL |
Ga0302311_102400003 | 3300030739 | Palsa | MFERFTDKARQVVFLAKGKATERGDDQIRPVHMLYGLAAADGVAARV |
Ga0265776_1101061 | 3300030880 | Soil | MFERFTDKARTVVILARAKATERGDQIRPVYMLYALASAEGVAARVLAS |
Ga0265740_10428751 | 3300030940 | Soil | MFERFTDKARKVVLLAKGKATERGDDQIRPVHLLYGLAA |
Ga0170820_105753651 | 3300031446 | Forest Soil | MFERFTDKARTAVIVARAEASERGDQIRPVYLLHALAAGQGVAAR |
Ga0318516_106612201 | 3300031543 | Soil | MFERFTDRARTAVILARTEASERGDQIRPVYMLHALAS |
Ga0318534_103883821 | 3300031544 | Soil | MFERFTDRARKVVILAKTKATERGDDQIRPVHMLYGLVGTDGV |
Ga0318538_102441083 | 3300031546 | Soil | MFERFTDRARTAVILARTEASERGDQIRPVYMLHALASVRA |
Ga0310915_102155263 | 3300031573 | Soil | MFERFTDRARTAVILARTEASERGDQIRPVYMLHALASGEGVAAQVLAG |
Ga0318561_104203291 | 3300031679 | Soil | MFERFTDRARKVVILAKTKATERGDDQIRPVHMLYGLVGTD |
Ga0310686_1066558873 | 3300031708 | Soil | MFERFTDKARTVVIAAKTKAQERGDDQIRPAHMLYG |
Ga0306917_100866621 | 3300031719 | Soil | MFERFTDKARKVVILATAKATERGEGEIRPVHMLYGVA |
Ga0318554_103212931 | 3300031765 | Soil | MFERFTDKARKVVILAKNKATERGDDQIRPVHMLYGLAGTDGVAA |
Ga0318554_105106731 | 3300031765 | Soil | MFERFTDQARQVVILAKGQATERGDDQIRPVHMLYGLAAAD |
Ga0318509_100751743 | 3300031768 | Soil | MFERFTDRARTAVIAARAEATARGDQIRPVYMLHALASGEG |
Ga0318526_102765832 | 3300031769 | Soil | MFERFTDRARTAVILARTEASERGDQIRPVYMLHALASGE |
Ga0318547_100653181 | 3300031781 | Soil | MFERFTDRARTAVIMARTEASERGDQIRPVYMLHALASGEGVA |
Ga0318548_102506911 | 3300031793 | Soil | MFERFTDRARTAVIMARTEASERGDQIRPVYMLHALASG |
Ga0318503_101441072 | 3300031794 | Soil | MFERFTDKARAVVILAKAKATERGDQIRPVYMLHALASAEG |
Ga0318557_102117171 | 3300031795 | Soil | MFERFTDKARKVVILAKNKATERGDDQIRPVHILY |
Ga0318564_100161145 | 3300031831 | Soil | MFERFTDKARKVVILAKNKATERGDDQIRPVHMLYGLAGTDGVA |
Ga0318517_103136431 | 3300031835 | Soil | MFERFTDKARTTVILAKAKATERGDQIRPVYMLHALAAGEGVTARV |
Ga0318511_102410871 | 3300031845 | Soil | MFERFTDKARAAVILARTEASERGDQIRPVYLLHARACGEGV |
Ga0318511_103097461 | 3300031845 | Soil | MFERFTDKARKVVILAKNKATERGDDQIRPVHILYG |
Ga0306919_109816383 | 3300031879 | Soil | MFERFTDKARKVVILAKNKAAERGDDQIRPVHMLY |
Ga0318551_107765662 | 3300031896 | Soil | MFERFTDRARTAVILARTEASERGDQIRPVYMLHALASSEGVQHVH |
Ga0318562_101662451 | 3300032008 | Soil | MFERFTDKARKVVHLATAKATERGEDEIRPVHMLYGLAA |
Ga0318562_106702041 | 3300032008 | Soil | MFERFTDRARTAVILARTEASERGDQIRPVYMLHALASG |
Ga0318549_100405261 | 3300032041 | Soil | MFERFTDRARTAVIAARAEATARGDQIRPVYMLHAL |
Ga0318549_105294121 | 3300032041 | Soil | MFERFTDKARKVVILAKNKAAERGDDQIRPVHMLYG |
Ga0318513_105545271 | 3300032065 | Soil | MFERFTDRARTAVILARTEASERGDQIRPVYMLHALASGEGVAAQVLA |
Ga0307470_108218792 | 3300032174 | Hardwood Forest Soil | MFERFTDKAKTAVIVAKADASERGDQIRPVYLLHALAAGEGIASRAL |
Ga0307471_1023040191 | 3300032180 | Hardwood Forest Soil | MFERFTDRARTVMILARTTAAARGDQIRPVYLLHALTSAD |
Ga0306920_1019313512 | 3300032261 | Soil | MFERFTDKARAVVILAKAKATERGDQIRPVYMLHAL |
Ga0306920_1019591511 | 3300032261 | Soil | MFERFTDKARKVVSVAAARAKEQGDDQIRPVHMLYALTATDGV |
Ga0335085_113428682 | 3300032770 | Soil | MFERFTGKARTVVILAKAKAAERGDQIRPVYMLHALASAQGVAAR |
Ga0335079_101477464 | 3300032783 | Soil | MFERFTDKARTVVILAKAKAAERDDQIRPVYMLYALASGDGVAARVL |
Ga0335074_106971213 | 3300032895 | Soil | MFERFTDKARKVVVAARDQAIEQGDDQIRPVHMLYGLAATDGVAGRV |
Ga0310914_103995041 | 3300033289 | Soil | MFERFTGRARTVVILAKAEAAERGDQIRPVYLLYALASG |
Ga0310914_114248351 | 3300033289 | Soil | MFERFTDKARAVVILAKAKATERGDQIRPVYMLHALASAEGVAARALAGLGVD |
Ga0310810_101662971 | 3300033412 | Soil | MFERFTDKARTAVIAARTEAAERGDQIRPVYMLHALAAG |
⦗Top⦘ |