NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102533

Metagenome / Metatranscriptome Family F102533

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102533
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 36 residues
Representative Sequence MKSLVKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD
Number of Associated Samples 65
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.99 %
% of genes near scaffold ends (potentially truncated) 28.71 %
% of genes from short scaffolds (< 2000 bps) 56.44 %
Associated GOLD sequencing projects 59
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.079 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil
(10.891 % of family members)
Environment Ontology (ENVO) Unclassified
(20.792 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(35.644 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 25.40%    β-sheet: 0.00%    Coil/Unstructured: 74.60%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF13847Methyltransf_31 20.79
PF04055Radical_SAM 14.85
PF00085Thioredoxin 10.89
PF07992Pyr_redox_2 5.94
PF13353Fer4_12 3.96
PF03625DUF302 3.96
PF02873MurB_C 1.98
PF03976PPK2 0.99
PF02635DrsE 0.99
PF13489Methyltransf_23 0.99
PF02579Nitro_FeMo-Co 0.99
PF01019G_glu_transpept 0.99
PF13545HTH_Crp_2 0.99
PF03266NTPase_1 0.99
PF11127DUF2892 0.99
PF02412TSP_3 0.99
PF13192Thioredoxin_3 0.99
PF00037Fer4 0.99
PF12801Fer4_5 0.99
PF08901DUF1847 0.99
PF01012ETF 0.99
PF10108DNA_pol_B_exo2 0.99
PF02518HATPase_c 0.99
PF12950TaqI_C 0.99
PF02687FtsX 0.99
PF00202Aminotran_3 0.99
PF00361Proton_antipo_M 0.99
PF05154TM2 0.99
PF13237Fer4_10 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 3.96
COG0812UDP-N-acetylenolpyruvoylglucosamine reductaseCell wall/membrane/envelope biogenesis [M] 1.98
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.99
COG1618Nucleoside-triphosphatase THEP1Nucleotide transport and metabolism [F] 0.99
COG2025Electron transfer flavoprotein, alpha subunit FixBEnergy production and conversion [C] 0.99
COG2086Electron transfer flavoprotein, alpha and beta subunitsEnergy production and conversion [C] 0.99
COG2314Uncharacterized membrane protein YozV, TM2 domain, contains pTyrGeneral function prediction only [R] 0.99
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.99
COG4887Uncharacterized metal-binding protein MJ0455, DUF1847 familyFunction unknown [S] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.08 %
UnclassifiedrootN/A7.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000228|TB_PC08_66DRAFT_10001017All Organisms → cellular organisms → Bacteria14490Open in IMG/M
3300000228|TB_PC08_66DRAFT_10002157All Organisms → cellular organisms → Bacteria10195Open in IMG/M
3300001213|JGIcombinedJ13530_105693632Not Available622Open in IMG/M
3300001213|JGIcombinedJ13530_105745321All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300001809|JGI20220J20339_1076191All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300001868|JGI24146J20443_1035217All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300002027|MIS_10060128All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptonema → Leptonema illini2563Open in IMG/M
3300002066|JGIcombinedJ21911_10000373All Organisms → cellular organisms → Bacteria14090Open in IMG/M
3300002068|JGIcombinedJ21913_10005622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales6012Open in IMG/M
3300002101|JGI24146J26653_1034068All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300002183|JGI24145J26757_10144797All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300002347|JGIcombinedJ26865_1027611All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300004154|Ga0066603_10505135All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia569Open in IMG/M
3300004282|Ga0066599_100349617All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia897Open in IMG/M
3300004282|Ga0066599_100818233All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300004282|Ga0066599_101271156Not Available553Open in IMG/M
3300005831|Ga0074471_10236662All Organisms → cellular organisms → Bacteria3797Open in IMG/M
3300005831|Ga0074471_10257974All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.1286Open in IMG/M
3300005831|Ga0074471_10351366Not Available1316Open in IMG/M
3300005831|Ga0074471_10460828All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300005831|Ga0074471_10481257All Organisms → cellular organisms → Bacteria1708Open in IMG/M
3300005831|Ga0074471_10564011All Organisms → cellular organisms → Bacteria3309Open in IMG/M
3300005831|Ga0074471_10632590All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes642Open in IMG/M
3300007959|Ga0079306_1000803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum24855Open in IMG/M
3300007959|Ga0079306_1001200All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes18201Open in IMG/M
3300007959|Ga0079306_1169176All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300009029|Ga0066793_10005318All Organisms → cellular organisms → Bacteria6500Open in IMG/M
3300009083|Ga0105047_10002548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales32461Open in IMG/M
3300009083|Ga0105047_10131088All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales3044Open in IMG/M
3300009111|Ga0115026_11371405All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300009131|Ga0115027_10070210All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300009131|Ga0115027_10405121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes955Open in IMG/M
3300009158|Ga0114977_10057418All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales2401Open in IMG/M
3300009175|Ga0073936_10031063All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia5440Open in IMG/M
3300009175|Ga0073936_10056139All Organisms → cellular organisms → Bacteria3586Open in IMG/M
3300009502|Ga0114951_10002204All Organisms → cellular organisms → Bacteria22478Open in IMG/M
3300009502|Ga0114951_10003553All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes16023Open in IMG/M
3300009502|Ga0114951_10132914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia1384Open in IMG/M
3300009755|Ga0115592_1104966All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300010138|Ga0115595_1063154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes633Open in IMG/M
3300010338|Ga0116245_10098463All Organisms → cellular organisms → Bacteria1742Open in IMG/M
3300010965|Ga0138308_100030All Organisms → cellular organisms → Bacteria134944Open in IMG/M
3300010965|Ga0138308_101329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia25112Open in IMG/M
3300011340|Ga0151652_10068643All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia2596Open in IMG/M
3300011340|Ga0151652_12741778All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300011340|Ga0151652_13753182All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes606Open in IMG/M
3300013315|Ga0173609_10578357Not Available549Open in IMG/M
3300014258|Ga0075315_1012517All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300014839|Ga0182027_10309169All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae1785Open in IMG/M
3300020048|Ga0207193_1002335All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia32963Open in IMG/M
3300020048|Ga0207193_1020392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8343Open in IMG/M
3300020163|Ga0194039_1002256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9863Open in IMG/M
3300021136|Ga0214167_1055576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella → Niabella hibiscisoli799Open in IMG/M
3300021520|Ga0194053_10015756All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica3665Open in IMG/M
3300021520|Ga0194053_10065400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1569Open in IMG/M
3300022555|Ga0212088_10002771All Organisms → cellular organisms → Bacteria36078Open in IMG/M
3300022555|Ga0212088_10025470All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica7556Open in IMG/M
3300022555|Ga0212088_10060032All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica3924Open in IMG/M
3300022555|Ga0212088_10072464All Organisms → cellular organisms → Bacteria3407Open in IMG/M
3300022555|Ga0212088_10242090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1372Open in IMG/M
3300025162|Ga0209083_1024074All Organisms → cellular organisms → Bacteria2965Open in IMG/M
3300025533|Ga0208584_1151803All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300025692|Ga0209744_1238472All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300025718|Ga0209123_1023714All Organisms → cellular organisms → Bacteria2858Open in IMG/M
3300025836|Ga0209748_1197466All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica695Open in IMG/M
3300025865|Ga0209226_10406731All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300027265|Ga0208789_1000058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes179730Open in IMG/M
3300027265|Ga0208789_1001413All Organisms → cellular organisms → Bacteria13535Open in IMG/M
3300027265|Ga0208789_1004303All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica4926Open in IMG/M
3300027871|Ga0209397_10084221Not Available1293Open in IMG/M
3300027887|Ga0208980_10093612All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica1762Open in IMG/M
3300027887|Ga0208980_10239076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1057Open in IMG/M
3300028032|Ga0265296_1200142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes695Open in IMG/M
(restricted) 3300028044|Ga0247838_1191193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes741Open in IMG/M
3300028176|Ga0268284_1001543All Organisms → cellular organisms → Bacteria11613Open in IMG/M
3300028178|Ga0265593_1002072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia8808Open in IMG/M
(restricted) 3300028571|Ga0247844_1007262All Organisms → cellular organisms → Bacteria12721Open in IMG/M
(restricted) 3300028581|Ga0247840_10054018All Organisms → cellular organisms → Bacteria3097Open in IMG/M
(restricted) 3300028581|Ga0247840_10142392All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica1460Open in IMG/M
(restricted) 3300029268|Ga0247842_10041450All Organisms → cellular organisms → Bacteria3293Open in IMG/M
(restricted) 3300029286|Ga0247841_10222100All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica1368Open in IMG/M
(restricted) 3300029286|Ga0247841_10257439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1233Open in IMG/M
3300031251|Ga0265327_10001361All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes31569Open in IMG/M
3300031521|Ga0311364_11988348Not Available570Open in IMG/M
3300031902|Ga0302322_100166750All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica2375Open in IMG/M
3300032173|Ga0315268_10005553All Organisms → cellular organisms → Bacteria13541Open in IMG/M
3300032275|Ga0315270_10006625All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6218Open in IMG/M
3300032275|Ga0315270_10035905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2743Open in IMG/M
3300032275|Ga0315270_10061931All Organisms → cellular organisms → Bacteria2120Open in IMG/M
3300032420|Ga0335397_10218589All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1784Open in IMG/M
3300032420|Ga0335397_10271369All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300033414|Ga0316619_11303524Not Available645Open in IMG/M
3300033418|Ga0316625_100908166All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300033486|Ga0316624_11754094All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300033521|Ga0316616_101245420All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300033521|Ga0316616_101798813All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300033521|Ga0316616_102092445Not Available752Open in IMG/M
3300034088|Ga0373912_0092525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes780Open in IMG/M
3300034123|Ga0370479_0092500All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300034128|Ga0370490_0048671All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica1393Open in IMG/M
3300034196|Ga0370503_0296675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes591Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil10.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.93%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion6.93%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)6.93%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland5.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.94%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface5.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.96%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.96%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland3.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater3.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater3.96%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland3.96%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater2.97%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil2.97%
Lake ChemoclineEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline1.98%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment1.98%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater1.98%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.98%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.99%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.99%
Sinkhole FreshwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater0.99%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.99%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.99%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.99%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.99%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.99%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.99%
SedimentEngineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment0.99%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.99%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000228Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001809Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300001868Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31AEnvironmentalOpen in IMG/M
3300002027Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5kEnvironmentalOpen in IMG/M
3300002066Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004)EnvironmentalOpen in IMG/M
3300002068Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300002101Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31AEnvironmentalOpen in IMG/M
3300002183Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22AEnvironmentalOpen in IMG/M
3300002347Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219)EnvironmentalOpen in IMG/M
3300004154Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300007959Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanotroph_Enrichment_5EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009083Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009755Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010138Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010338AD_JPMRcaEngineeredOpen in IMG/M
3300010965Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621EnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300013315Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1BEngineeredOpen in IMG/M
3300014258Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020163Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8mEnvironmentalOpen in IMG/M
3300021136Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnionEnvironmentalOpen in IMG/M
3300021520Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8mEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300025162Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025533Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025692Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes)EnvironmentalOpen in IMG/M
3300025718Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-31A (SPAdes)EnvironmentalOpen in IMG/M
3300025836Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025865Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes)EnvironmentalOpen in IMG/M
3300027265Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanotroph_Enrichment_5 (SPAdes)EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300028032Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1EnvironmentalOpen in IMG/M
3300028044 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15mEnvironmentalOpen in IMG/M
3300028176Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_40mEnvironmentalOpen in IMG/M
3300028178Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36mEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300029268 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19mEnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032420Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034088Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.1EngineeredOpen in IMG/M
3300034123Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15EnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034196Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TB_PC08_66DRAFT_10001017133300000228GroundwaterMLSNSKTKKIEIMKSLVKKKIEVQKVNTKKVAQCCAKTSKTVVGCHD*
TB_PC08_66DRAFT_1000215723300000228GroundwaterMKSLVKKKIEVQKVNTKKVAQCCAKTSKTVVGCHD*
JGIcombinedJ13530_10569363213300001213WetlandNVVKMKSLVKKKIMKVEAKPAQCCAKVSKTVVGCHD*
JGIcombinedJ13530_10574532123300001213WetlandMKSLVKKKERKANETAKPAQCCAKISKIIVGCHD*
JGI20220J20339_107619123300001809WetlandMKSLVKKKVKVEKAETKKEAQCCAKTSKTVVGCHD*
JGI24146J20443_103521733300001868Arctic Peat SoilMTIMKSLIKKKEGKVNAKAAQCCAKTSKIIVGCHD*
MIS_1006012853300002027Sinkhole FreshwaterMKSLVKKIETVKVNQEVTKKVAQCCAKTSKTIVGCHD*
JGIcombinedJ21911_1000037353300002066Arctic Peat SoilMTIMKSLIKKKEGKVNAKPAQCCAKTSKIIVGCHD*
JGIcombinedJ21913_1000562253300002068Arctic Peat SoilMTIMKSLIKKKEGKVNAKPAQCCATSKIIVGCHD*
JGI24146J26653_103406823300002101Arctic Peat SoilMTIMKSLIKKKEGKVNAKXAQCCAKTSKIIVGXHD*
JGI24145J26757_1014479723300002183Arctic Peat SoilMTIMKSLIKKKEGKVNAKPAQCCAXTSKIIVGCHD*
JGIcombinedJ26865_102761123300002347Arctic Peat SoilMTIMKSLIKKKEGKVSAKPAQCCAKTSKIIVGCHD*
Ga0066603_1050513523300004154FreshwaterNKKINFMKSLVKKKVEVQKATSKKVAQCCAKTSKTVVGCHD*
Ga0066599_10034961723300004282FreshwaterMKSLVKKNTGKAGVKVKASENAKPAQCCAKTSKIIVGCHD*
Ga0066599_10081823323300004282FreshwaterMKSLVKKNNVKASAKANGNGNAKPAQCCAKTSKIIVGCHD*
Ga0066599_10127115623300004282FreshwaterFTYKIIDMKSVIRKKEKRNNTKTAQCCAKTSKTVVGCHD*
Ga0074471_1023666223300005831Sediment (Intertidal)MKTLVKKKVEAQKVNTKKVAQCCAKTSKAVVGCHD*
Ga0074471_1025797423300005831Sediment (Intertidal)MKSLVKKKIEVQKVNAKKVAQCCAKTSKTVVGCHD*
Ga0074471_1035136613300005831Sediment (Intertidal)SNSINQTYMTSLIKKKKVEVEAKVAQCCAKTSKNVVGCHD*
Ga0074471_1046082823300005831Sediment (Intertidal)MSYEKSDQKKIEKENVKVAQCCAKTSKTVAGCHD*
Ga0074471_1048125723300005831Sediment (Intertidal)MKTLVKKKIEAQKINTKKVAQCCAKTSKTVVGCHD*
Ga0074471_1056401113300005831Sediment (Intertidal)TTMKSLIKKKDGKVNTKVAQCCAKTSKTVVGCHD*
Ga0074471_1063259023300005831Sediment (Intertidal)THMKSLIKKKVEVQKTNTKKVAQCCAKTSKTVVGCHD*
Ga0079306_1000803173300007959Deep SubsurfaceMKSLVKKKIEVQKVNTKKVAQCCAKTSKTIVGCHD*
Ga0079306_100120053300007959Deep SubsurfaceMKSLVKKKMEVQKVNTKKTAQCCAKTSKTVVGCHD*
Ga0079306_116917623300007959Deep SubsurfaceMKSLVKKKIEVQKVNTKKVAQCCAKTSTTVVGCHD*
Ga0066793_1000531893300009029Prmafrost SoilMTIMKTLIKKKEGKVNAKPAQCCAKTSKIIVGCHD*
Ga0105047_1000254823300009083FreshwaterMKSLIKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD*
Ga0105047_1013108833300009083FreshwaterMKTLVKKKVETQKVNTKKVAQCCAKTSKTVVGCHD*
Ga0115026_1137140523300009111WetlandMKSLVKKKEGKVKANENAKPAQCCAKTSKIIVGCHD*
Ga0115027_1007021053300009131WetlandMKSLVKKKIEIQKVNTKKVAQCCAKTSKTVVGCHD*
Ga0115027_1040512113300009131WetlandIETMKNLVKKKVKVEKANEKKEAQCCAKTSKTVVGCHD*
Ga0114977_1005741823300009158Freshwater LakeMKTLVKKKIENQKTNTKKVAQCCAKTSKAVVGCHD*
Ga0073936_1003106313300009175Freshwater Lake HypolimnionYNTMKCLVKKQNEKEPIKKVAQCCAKTSKTIVGCHD*
Ga0073936_1005613923300009175Freshwater Lake HypolimnionMKSLIKKKVKVQKAETKKVAQCCAKTSKTIVGCHD*
Ga0114951_1000220463300009502FreshwaterMIMKTLIKKKVQKAVEKKPAQCCAKTSKVVAGCHD*
Ga0114951_10003553183300009502FreshwaterMKSLVKKKVKAPKAETKKVAQCCAKTSKTIVGCHD*
Ga0114951_1013291443300009502FreshwaterQQRLINYFFMKSLIKKKEPKKVEVAQCCAKTSRTVVGCHD*
Ga0115592_110496623300009755WetlandKSLVKKKEGKEKANENAKPAQCCAKTSKIIVGCHD*
Ga0115595_106315413300010138WetlandLKIETMKSLIKKKIKVEKETAKKEAQCCAKTSKTVVGCHD*
Ga0116245_1009846323300010338Anaerobic Digestor SludgeMKSLIKIKQPTKKQSPKKAQCCAKLSKTTVGCHD*
Ga0138308_100030623300010965Lake ChemoclineMKTLVKKKIETQKVNTKKVAQCCAKTSKTVVGCHD*
Ga0138308_101329163300010965Lake ChemoclineMKSLVKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD*
Ga0151652_1006864323300011340WetlandMKSLFKKKERKANETAKPAQCCAKISKIIVGCHD*
Ga0151652_1274177823300011340WetlandMKSLIKKKIKVEKENAKKEAQCCAKTSKTVVGCHD*
Ga0151652_1375318223300011340WetlandKIQTMKSLVKKKVKAPKAETKKVAQCCAKTSKTIVGCHD*
Ga0173609_1057835713300013315SedimentIPVIMKSLIKKKESKVNAKPAQCCAKTSKIIVGCHD*
Ga0075315_101251723300014258Natural And Restored WetlandsVLLIFKIDFMKSLVKRKEKKLKTKEAQCCAKTSKNVAGCHD*
Ga0182027_1030916913300014839FenNKFNITHSKKLSMKSLVKKKEISSNTKTAQCCAKTSKTIVGCHD*
Ga0207193_1002335273300020048Freshwater Lake SedimentMKTLVKKKIENQKTNTKKVAQCCAKTSKAVVGCHD
Ga0207193_102039253300020048Freshwater Lake SedimentMKSLIKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD
Ga0194039_100225693300020163Anoxic Zone FreshwaterMKSLVKKKIKIEKANSKKVAQCCAKTSKTIVGCHD
Ga0214167_105557623300021136FreshwaterVITITQKLIFMKSLIKKKEEPKAVKIAQCCAKTSRTVVGCHD
Ga0194053_1001575643300021520Anoxic Zone FreshwaterMKSLVKKKIKVEKASTKKVAQCCAKTSKTIVGCHD
Ga0194053_1006540023300021520Anoxic Zone FreshwaterTKISTMKSLVKKKVKVEKVNTKKVAQCCAKTSKTVMGCHD
Ga0212088_10002771193300022555Freshwater Lake HypolimnionMKSLVKKKTNVEKANTKKTAQCCAKTSKTIVGCHD
Ga0212088_1002547063300022555Freshwater Lake HypolimnionMIMKTLIKKKVQKAVEKKPAQCCAKTSKVVAGCHD
Ga0212088_1006003243300022555Freshwater Lake HypolimnionMKSLVKKKVKAPKAETKKVAQCCAKTSKTIVGCHD
Ga0212088_1007246453300022555Freshwater Lake HypolimnionNQILTIKTETMKSLIKKKVKVQKAETKKVAQCCAKTSKTIVGCHD
Ga0212088_1024209013300022555Freshwater Lake HypolimnionFPKYKRGKAIQQRLINYFFMKSLIKKKEPKKVEVAQCCAKTSRTVVGCHD
Ga0209083_102407423300025162FreshwaterMKSLVKKKTEIETANSKKVAQCCAKTSATIVGCHD
Ga0208584_115180313300025533Arctic Peat SoilMTIMKSLIKKKEGKVNAKPAQCCAKTSKIIVGCHD
Ga0209744_123847223300025692Arctic Peat SoilMTIMKSLIKKKEGKVNAKAAQCCAKTSKIIVGCHD
Ga0209123_102371433300025718Arctic Peat SoilMKTLVKKKIEIQKVNTQKVAQCCAKTSKTVVGCHD
Ga0209748_119746623300025836Arctic Peat SoilMSIMKSLIKKKEVKVSVKPAQCCAKTSKTIVGCHD
Ga0209226_1040673123300025865Arctic Peat SoilMTNMKSLIKKKEGKVNAKAAQCCTKTSKIIVGCHD
Ga0208789_1000058653300027265Deep SubsurfaceMKSLVKKKMEVQKVNTKKTAQCCAKTSKTVVGCHD
Ga0208789_1001413143300027265Deep SubsurfaceMKSLVKKKIEVQKVNTKKVAQCCAKTSKTIVGCHD
Ga0208789_100430323300027265Deep SubsurfaceMKSLVKKKIEVQKVNTKKVAQCCAKTSTTVVGCHD
Ga0209397_1008422123300027871WetlandLKIETMKSLVKKKVKVEKANTKKEAQCCAKTSKAVVGCHD
Ga0208980_1009361223300027887WetlandMKSLIKKKIKVEKENAKKEAQCCAKTSKTTVGCHD
Ga0208980_1023907623300027887WetlandMKSLVKKKIKVEKENAKKEAQCCAKSSKTVVGCHD
Ga0265296_120014223300028032GroundwaterLLIFKFEFMKSLVKKKTQKTSTKKVAQCCAKTSKTIVGCHD
(restricted) Ga0247838_119119323300028044FreshwaterTMKSLIKKKVKVEKVNSKKVAQCCAKTSKTIVGCHD
Ga0268284_1001543143300028176Saline WaterMKSLVKKKVKVQKADTKKVAQCCAKTSKTIVGCHD
Ga0265593_1002072113300028178Saline WaterMKSLVKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD
(restricted) Ga0247844_100726293300028571FreshwaterMKSLIKKKVKVEKVNSKKVAQCCAKTSKTIVGCHD
(restricted) Ga0247840_1005401863300028581FreshwaterMKSLVKKKVKVEKVSTKKVAQCCAKTSKTIVGCHD
(restricted) Ga0247840_1014239223300028581FreshwaterMKSLIKKKIKVEKANSKKVAQCCAKTSKTIVGCHD
(restricted) Ga0247842_1004145043300029268FreshwaterMKSLVKKKVKVEKVNTKKVAQCCAKTSKTIVGCHD
(restricted) Ga0247841_1022210023300029286FreshwaterMKTLVKKTVKVEKISTKSSAQCCAKTSKNVPGCHD
(restricted) Ga0247841_1025743923300029286FreshwaterMKSLVKKKIKVEKENAKKEAQCCAKTSKTVVGCHD
Ga0265327_10001361183300031251RhizosphereMKSLVKKKTKEKTETKTKTALCCAKTSKAIPGCHD
Ga0311364_1198834823300031521FenMKSLVKKKLEAQKVNTKKVAQCCAKTSKTVVGCHD
Ga0302322_10016675013300031902FenLTQSKFRIMKSLIKKKETRTIVKVAQCCAKTSKTVVGCHD
Ga0315268_10005553133300032173SedimentMKSLIKKKVETQKVNTKKVAQCCAKTSKTVVGCHD
Ga0315270_1000662593300032275SedimentMKSLVKKKIETQKVNTPKVAQCCAKTSKTVVGCHD
Ga0315270_1003590523300032275SedimentMKTLVKKKIEAQKINTKKVAQCCAKTSKTVVGCHD
Ga0315270_1006193143300032275SedimentMKSLVKKKIEVQKVDTKKVAQCCAKTSKTVVGCHD
Ga0335397_1021858913300032420FreshwaterIFNMKTLVKKKVETQKVNTKKVAQCCAKTSKTVVGCHD
Ga0335397_1027136943300032420FreshwaterMKTLVKKKVETQKVNTKKVAQCCAKTSKTVVGCHD
Ga0316619_1130352413300033414SoilYLNKIMKSVIKKKETRKQIKTAQCCAKTSKTVVGCHD
Ga0316625_10090816623300033418SoilMKSLVKKKVKVEKANEKKEAQCCAKSSKTVVGCHD
Ga0316624_1175409413300033486SoilYFKSQITIMKSLIKNKANKVKAKVAQCCAKISKTIAGCHD
Ga0316616_10124542023300033521SoilMKSLVKKKIEVQKVNTQKVAQCCAKTSKTVVGCHD
Ga0316616_10179881323300033521SoilMKSLVKKKVKVEKANEKKEAQCCAKTSKTVVGCHD
Ga0316616_10209244523300033521SoilMKSLVKKKIEVKKESAKKTAQCCAKTSKTVVGCHD
Ga0373912_0092525_198_3053300034088Sediment SlurryMKSLVKKKTEVQKVNTKKVAQCCAKTSKTVVGCHD
Ga0370479_0092500_676_7923300034123Untreated Peat SoilIKLLKIMKSLIKKKAERVTAKPAQCCAKTSKTIVGCHD
Ga0370490_0048671_371_4783300034128Untreated Peat SoilMKSLIKKKIKVEKENAKKEAQCCAKTSKNVVGCHD
Ga0370503_0296675_2_1243300034196Untreated Peat SoilTKIEIIKSLLKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.