Basic Information | |
---|---|
Family ID | F105124 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 43 residues |
Representative Sequence | LDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFLLGLY |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.00 % |
% of genes near scaffold ends (potentially truncated) | 98.00 % |
% of genes from short scaffolds (< 2000 bps) | 98.00 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (13.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (30.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF01059 | Oxidored_q5_N | 58.00 |
PF00361 | Proton_antipo_M | 21.00 |
PF00893 | Multi_Drug_Res | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.00 % |
Unclassified | root | N/A | 2.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000890|JGI11643J12802_11327446 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300001213|JGIcombinedJ13530_106146635 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300003988|Ga0055475_10200399 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300004022|Ga0055432_10079453 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300004114|Ga0062593_100922111 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300004114|Ga0062593_102937960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300004156|Ga0062589_101723981 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300004463|Ga0063356_105418598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300004643|Ga0062591_101854455 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300004643|Ga0062591_102184352 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300005445|Ga0070708_102062365 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005447|Ga0066689_10698697 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300005556|Ga0066707_10675849 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300005558|Ga0066698_10734454 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300005836|Ga0074470_11191052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1310 | Open in IMG/M |
3300005836|Ga0074470_11483066 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300005843|Ga0068860_102585813 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005844|Ga0068862_100222664 | Not Available | 1709 | Open in IMG/M |
3300006034|Ga0066656_10807377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
3300006042|Ga0075368_10384049 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300006051|Ga0075364_11061846 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300006577|Ga0074050_11955737 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300006796|Ga0066665_11092549 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300007255|Ga0099791_10128354 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
3300009053|Ga0105095_10312930 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300009091|Ga0102851_13552080 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300009094|Ga0111539_12380452 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300009100|Ga0075418_12954954 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300009100|Ga0075418_12983911 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300009147|Ga0114129_11020404 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300009156|Ga0111538_11997194 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300009166|Ga0105100_10978872 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300009168|Ga0105104_10688290 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300009179|Ga0115028_10805398 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300009179|Ga0115028_11087615 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300009506|Ga0118657_11236973 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300010029|Ga0105074_1050692 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300011432|Ga0137428_1216421 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300012129|Ga0137345_1055939 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300012189|Ga0137388_11277248 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300012918|Ga0137396_10375581 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300015254|Ga0180089_1134521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
3300015371|Ga0132258_12808179 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1213 | Open in IMG/M |
3300015374|Ga0132255_105609412 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300018058|Ga0187766_11290971 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300018059|Ga0184615_10349052 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300018060|Ga0187765_10573111 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300018063|Ga0184637_10651091 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300018079|Ga0184627_10307267 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300019487|Ga0187893_10937731 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300021090|Ga0210377_10355746 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300021090|Ga0210377_10548989 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300021859|Ga0210334_10507242 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300023261|Ga0247796_1013878 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
(restricted) 3300024528|Ga0255045_10488878 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300025160|Ga0209109_10240171 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300025313|Ga0209431_10052579 | All Organisms → cellular organisms → Bacteria | 3163 | Open in IMG/M |
3300025318|Ga0209519_10267723 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300025324|Ga0209640_10440922 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300025923|Ga0207681_10531412 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300025964|Ga0210127_1015480 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300026088|Ga0207641_11910557 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300026492|Ga0256802_1037018 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300027675|Ga0209077_1143664 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300027695|Ga0209966_1164746 | Not Available | 518 | Open in IMG/M |
3300027831|Ga0209797_10267276 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300027866|Ga0209813_10340946 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300027873|Ga0209814_10224276 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300028711|Ga0307293_10087204 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300028869|Ga0302263_10130612 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300031232|Ga0302323_100994770 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300031277|Ga0307425_1091918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 990 | Open in IMG/M |
3300031834|Ga0315290_11558892 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300031858|Ga0310892_10045737 | All Organisms → cellular organisms → Bacteria | 2138 | Open in IMG/M |
3300031908|Ga0310900_10903558 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300031997|Ga0315278_11467604 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300032010|Ga0318569_10507017 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300032012|Ga0310902_10590529 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300032273|Ga0316197_10711611 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300032421|Ga0310812_10384739 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300032897|Ga0335071_11238209 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300033004|Ga0335084_11485045 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300033406|Ga0316604_10494180 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300033413|Ga0316603_11676940 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300033414|Ga0316619_11052025 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300033417|Ga0214471_11296807 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300033418|Ga0316625_100155486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1421 | Open in IMG/M |
3300033434|Ga0316613_10624166 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300033493|Ga0316631_10143142 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300033513|Ga0316628_103249675 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300033513|Ga0316628_103464321 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300033513|Ga0316628_103623203 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300033521|Ga0316616_103431654 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300033521|Ga0316616_104745695 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300033815|Ga0364946_158189 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300033815|Ga0364946_159105 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300034077|Ga0373899_016021 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300034114|Ga0364938_096392 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300034151|Ga0364935_0055772 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300034690|Ga0364923_0195718 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 13.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.00% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 5.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.00% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.00% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.00% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 3.00% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.00% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.00% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.00% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.00% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.00% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.00% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.00% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.00% |
Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 1.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.00% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.00% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.00% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 1.00% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.00% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300003988 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2 | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
3300012129 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025964 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026492 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5 | Environmental | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031277 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-30 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032273 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxic | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
3300034077 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.3 | Engineered | Open in IMG/M |
3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11643J12802_113274462 | 3300000890 | Soil | AVNLTAAVFDSASYVLRALQNGLVQHYALSALIGVFLMIAAGRFLLSLY* |
JGIcombinedJ13530_1061466351 | 3300001213 | Wetland | LSYLFRAVQNGLVQHYVLVSLIGVFLLIGAGRFVLGLY* |
Ga0055475_102003992 | 3300003988 | Natural And Restored Wetlands | FVIDNLSYAFRSVQNGLVQHYVLSMLIGIFLLVFAGRFVLGLY* |
Ga0055432_100794531 | 3300004022 | Natural And Restored Wetlands | IVDGSVNLMAAILDNSSYLFRAVQNGLVQSYALSMLVGIFLLLAAGRFLLGLY* |
Ga0062593_1009221111 | 3300004114 | Soil | VNLVAGVFDNVSYVFRAVQNGFVQSYALAMLIGVFFIIGAGHFVLHLY* |
Ga0062593_1029379602 | 3300004114 | Soil | NLIAFVLDSLSYLFRAVQNGLVQHYAFAMLVGVLLLIASGGWILRLY* |
Ga0062589_1017239812 | 3300004156 | Soil | NASYALRALQNGLVQHYALGMLIGLFLLIAAGRFLLGLY* |
Ga0063356_1054185981 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DNGSYVFRAVQNGLVQHYALAMLIGVFLIIGAGRFLLGLY* |
Ga0062591_1018544551 | 3300004643 | Soil | DGAVNLTAAVLDSASYVLRALQNGLVQHYALSALIGVFLMIAAGRFLLSLY* |
Ga0062591_1021843521 | 3300004643 | Soil | FVLDSLSYLFRAVQNGLVQHYAFAMLVGVLLLIASGGWILRLY* |
Ga0070708_1020623652 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DNASYVLRALQNGLVQHYALSALIGVFLMIWAGRFVLHLY* |
Ga0066689_106986971 | 3300005447 | Soil | VNLTAGILDNFSYVFRSVQNGLVQSYALAMLIGVFFIIGAGHFVLHLY* |
Ga0066707_106758492 | 3300005556 | Soil | VLRALQNGLVQHYALSALIGVFLMIWAGRFVLHLY* |
Ga0066698_107344541 | 3300005558 | Soil | VLRALQNGLVQHYALSALIGVFLLIGAMGFVLRLY* |
Ga0074470_111910521 | 3300005836 | Sediment (Intertidal) | TAFVLDNLSYAFRAVQSGLVQSYALSMLIGLFLLIAAGRFFLGLY* |
Ga0074470_114830662 | 3300005836 | Sediment (Intertidal) | MATVLEQVSYLFRAVQNGLVQSYALSMLIGFLLIFAAGRFLLGLY* |
Ga0068860_1025858131 | 3300005843 | Switchgrass Rhizosphere | FRAVQNGLVQQYALAMLIGVFLLIGAGGFLLGLY* |
Ga0068862_1002226641 | 3300005844 | Switchgrass Rhizosphere | FRAVQNGLVQSYALAMLIGVFLIIGAGAFIFNLY* |
Ga0066656_108073771 | 3300006034 | Soil | DNASYVLRALQNGLVQHYALSALIGVFLLIGAMGFVLRLY* |
Ga0075368_103840491 | 3300006042 | Populus Endosphere | VNAVAVALEQGSYLFRSVQNGLVQHYALAMIIGVFFLIAAGKFVLGLY* |
Ga0075364_110618462 | 3300006051 | Populus Endosphere | AFVLDNTSYLFRAVQNGLVQHYALTMLFGVFLIIAAGHWVLRLY* |
Ga0074050_119557371 | 3300006577 | Soil | AGTALDNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFMLGLY* |
Ga0066665_110925491 | 3300006796 | Soil | SSYVLRALQNGLVQHYALSALIGDFLMIWAGRFLLRLY* |
Ga0099791_101283542 | 3300007255 | Vadose Zone Soil | VLRALQNGLVQHYALSALIVVFLMIAAGGFVLRLY* |
Ga0105095_103129301 | 3300009053 | Freshwater Sediment | FRAVQSGLVQNYALSMLIGVFLLIAAGRFVLGLY* |
Ga0102851_135520801 | 3300009091 | Freshwater Wetlands | LFRAVQNGLVQHYVLVSLIGVFLLIGAGRFVLGLY* |
Ga0111539_123804522 | 3300009094 | Populus Rhizosphere | FRSVQNGLVQHYALAMIIGVFFLIAAGKFVLGLY* |
Ga0075418_129549541 | 3300009100 | Populus Rhizosphere | AFVLDEGSYVFRSVQNGLVQHYALAMLIGLFLMIGAGHFVLRLY* |
Ga0075418_129839112 | 3300009100 | Populus Rhizosphere | ALRALQNGLVQHYALGMLIGLFLLIAAGRFLLGLY* |
Ga0114129_110204042 | 3300009147 | Populus Rhizosphere | YALRALQNGLVQHYALGMLIGLFLLIAAGRFLLGLY* |
Ga0111538_119971942 | 3300009156 | Populus Rhizosphere | YLFRSVQNGLVQHYALAMIIGVFFLIAAGKFVLGLY* |
Ga0105100_109788722 | 3300009166 | Freshwater Sediment | DNLSYAVRAVQSGLVQHYALSMLIGLFLLIAAGRFLLGLY* |
Ga0105104_106882901 | 3300009168 | Freshwater Sediment | LSYAFRAVQSGFVQHYALSMLIGIFLLIAAGRFLLGLY* |
Ga0115028_108053981 | 3300009179 | Wetland | LDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFLLGLY* |
Ga0115028_110876152 | 3300009179 | Wetland | VNFTAFVLDNLSYAFRAVQSGLVQSYALSMLIGLFLLTAAGRFLLGLY* |
Ga0118657_112369732 | 3300009506 | Mangrove Sediment | NVSYVFRAVQNGLVQHYALAMLIAVLFLIGASRFIQ* |
Ga0105074_10506921 | 3300010029 | Groundwater Sand | VFRAVQNGLVQHYALSMLIGVFLLFIAGRFLLGLY* |
Ga0137428_12164211 | 3300011432 | Soil | LSYVFRAAQTGVVQHYALGLMIGLFLLIAAGRFVLGLY* |
Ga0137345_10559392 | 3300012129 | Soil | AILDNLSYVFRAVQNGLVQRYALSMLIAVFLMIGASLFIL* |
Ga0137388_112772482 | 3300012189 | Vadose Zone Soil | YLFRAVQNGLVQHYALSMLIGVFLLIAAGRFVLGLY* |
Ga0137396_103755812 | 3300012918 | Vadose Zone Soil | DNSSYVLRALQNGLVQHYALSALIGVFLMIWAGRFVLRLY* |
Ga0180089_11345212 | 3300015254 | Soil | MLGPVLQWRDHTAAILDNLSYVVRAAQNGLVQQYALSMLIGLFLLIAAGRFVLGLY* |
Ga0132258_128081792 | 3300015371 | Arabidopsis Rhizosphere | ALDNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFVLGLY* |
Ga0132255_1056094121 | 3300015374 | Arabidopsis Rhizosphere | SYVFRAVQNGFVQSYALAMLIGVFFIIGAGHFVLHLY* |
Ga0187766_112909711 | 3300018058 | Tropical Peatland | LSYALRAVQDGLVQHYALGMLIGLFLLIAATRFLLGLT |
Ga0184615_103490521 | 3300018059 | Groundwater Sediment | DGAVNLTAFVLDNLSYAFRAVQSGLVQSYALSMLIGLFLLIAAGRFFLGLY |
Ga0187765_105731111 | 3300018060 | Tropical Peatland | GAVNLAAFLLDNLSYAFRAVQDGLVQHYALGMLIGLFLLVAAGRFLLGLY |
Ga0184637_106510911 | 3300018063 | Groundwater Sediment | WDRHVVDGAVKLTAFGFENLSYAFRAAQSGLVQHYALGMLIGLFLMIAAGRFVLGLY |
Ga0184627_103072671 | 3300018079 | Groundwater Sediment | VNLTAAIFDSLSYLFRAVQNGLVQQYALAMIMGILVLIGAGSWVLGLY |
Ga0187893_109377312 | 3300019487 | Microbial Mat On Rocks | VNLTALVLDNFSYVFRAVQNGLVQHYALVMLIGIFLMIAAGRWPLALY |
Ga0210377_103557462 | 3300021090 | Groundwater Sediment | DNFSYLFRAVQNGLVQHYALVMLIGVFLMIGAGRWVLGLY |
Ga0210377_105489891 | 3300021090 | Groundwater Sediment | FVLDNLSYAFRAVQNGLVQNYALSMLIGLFLLIAAGRFLLGLY |
Ga0210334_105072422 | 3300021859 | Estuarine | YAFRAVQNGQIQSYALAMLIGIFLIIGAGRFLLGLY |
Ga0247796_10138781 | 3300023261 | Soil | SYLFRSVQNGLVQHYALAMIIGVFFLIAAGKFVLGLY |
(restricted) Ga0255045_104888781 | 3300024528 | Seawater | YAFRSVQNGLVQHYVLSMLIGVFLLIFAGRFLLGLY |
Ga0209109_102401711 | 3300025160 | Soil | SYLFRAVQNGLVQSYALSMLIGVFLLIAAGRYLLGLY |
Ga0209431_100525794 | 3300025313 | Soil | VNLTAFLLDNLSYAFRAVQNGLVQHYALGMLIGIFLLIAAGRFLLGLY |
Ga0209519_102677232 | 3300025318 | Soil | GAVTLTAFLLDNLSYALRAVQNGLVQHYALSMMIGLFLLIAAGRFVLGLY |
Ga0209640_104409221 | 3300025324 | Soil | DNLSYVFRSVQNGLVQSYALAMLIGVFFIIGAGHFVLHLY |
Ga0207681_105314121 | 3300025923 | Switchgrass Rhizosphere | GAVNATGLVLDNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFLLGLY |
Ga0210127_10154801 | 3300025964 | Natural And Restored Wetlands | SYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFILGLY |
Ga0207641_119105572 | 3300026088 | Switchgrass Rhizosphere | FDNFSYVFRAVQNGLVQSYALAMLIGVFLIIGAGAFIFNLY |
Ga0256802_10370182 | 3300026492 | Sediment | LTAFVLDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFILGLY |
Ga0209077_11436641 | 3300027675 | Freshwater Sediment | LVNLTAFVLDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFLLGLY |
Ga0209966_11647463 | 3300027695 | Arabidopsis Thaliana Rhizosphere | LVRAVQNGLVQSYALAMLIGVFLVIWAGSAILHLY |
Ga0209797_102672762 | 3300027831 | Wetland Sediment | SYAFRAVQDGLVQHYALSMLIGLFLLIAAGRFLLGLY |
Ga0209813_103409461 | 3300027866 | Populus Endosphere | VNAVAVALEQGSYLFRSVQNGLVQHYALAMIIGVFFLIAAGKFVLGLY |
Ga0209814_102242762 | 3300027873 | Populus Rhizosphere | ILDNASYVLRALQNGLVQHYALSALIGVFLMIWAGRFVLHLY |
Ga0307293_100872041 | 3300028711 | Soil | GAVNLAAAILDNASYVLRALQNGLVQHYALSALIGVFLLIGAMGFVLRLY |
Ga0302263_101306121 | 3300028869 | Fen | DGAVNLAAFLLDNLSYAFRAVQDGLVQHYALSMLIGLFLLIAAGRFVLGLY |
Ga0302323_1009947701 | 3300031232 | Fen | ILDNTSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFVLGLY |
Ga0307425_10919182 | 3300031277 | Salt Marsh | AWILDNLSYAFRAFQNGLVQQYALAMLIAVLFMIGASLLIQ |
Ga0315290_115588921 | 3300031834 | Sediment | TAFLLDNLSYVFRAAQNGLVQQYALSMLIGLFLLIAAGRFVLGLY |
Ga0310892_100457373 | 3300031858 | Soil | MAFDNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFLLGLY |
Ga0310900_109035581 | 3300031908 | Soil | LDNLSYAFRAAQNGLVQSYALSMLIGVFLLFWAGHALLGLY |
Ga0315278_114676042 | 3300031997 | Sediment | AVNLTAFVLDNLSYALRAVQNGLVQNYALSMLIGLFLLIAAGRFLLGLY |
Ga0318569_105070171 | 3300032010 | Soil | VKATGFVLENLSYALRALQNGLVQHYALGMLIGLFLLIAAGRFLLWLY |
Ga0310902_105905292 | 3300032012 | Soil | MAFDNASYALRALQNGLVQHYALGMLIGLFLLIAAGRFVLGLY |
Ga0316197_107116111 | 3300032273 | Sediment | VDGAVNATAFVLDNLSYAFRAVQNGLVQHYALSMLIGIFLLIFAGRFVLGLY |
Ga0310812_103847392 | 3300032421 | Soil | YLFRAVQNGLVQSYALSMLIGVFVLIVVGAALGLY |
Ga0335071_112382092 | 3300032897 | Soil | TAFVLDNLSYAVRAVQSGFVQHYALGMLIGIFLLIAAGRFLLGLY |
Ga0335084_114850452 | 3300033004 | Soil | NLTAFVLDNLSYAVRAVQSGLVQSYALSMLIGIFLLIAAGRFLLGLY |
Ga0316604_104941802 | 3300033406 | Soil | FTAFVLDNLSYAVRAVQSGLVQNYALSMLIGLFLLIAAGRFLLGLY |
Ga0316603_116769401 | 3300033413 | Soil | SYAFRAVQNGLVQNYALSMLIGLFLLIAAGRFLLGLY |
Ga0316619_110520251 | 3300033414 | Soil | VNLTAFVLDNLSYAVRAVQSGLVQNYALSMLIGLFLLIAAGRFLLGLY |
Ga0214471_112968072 | 3300033417 | Soil | NFSYVFRSVQNGLVQSYALAMLIGVFLIIGAGHFVLHLY |
Ga0316625_1001554861 | 3300033418 | Soil | DNTSYAFRAVQDGLVQHYALSMLIGLFLLIAAGRFVLGLY |
Ga0316613_106241661 | 3300033434 | Soil | AVRAVQSGLVQNYALSMLIGLFLLIAAGRFLLGLY |
Ga0316631_101431422 | 3300033493 | Soil | DGAVNFTAFVLDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFLLGLY |
Ga0316628_1032496751 | 3300033513 | Soil | TSYAFRAVQDGLVQHYALGMLIGLFLLIAAGRFVLGLY |
Ga0316628_1034643212 | 3300033513 | Soil | LDNLSYAVRAVQTGLVQNYALSMLIGIFLLIAAGRFLLGLY |
Ga0316628_1036232031 | 3300033513 | Soil | AVRAVQSGLVQNYALSMLIGIFLLIAAGRFLLGLY |
Ga0316616_1034316541 | 3300033521 | Soil | AVNLTALVLDNLSYAFRAVQNGLVQHYALSMLIGLFLLIAAGRFLLGLY |
Ga0316616_1047456952 | 3300033521 | Soil | GLVNLMAFVLDNTSYAFRAVQDGLVQHYALSMLIGLFLLIAAGRFVLGLY |
Ga0364946_158189_5_151 | 3300033815 | Sediment | VNLAAFVLDNLSYLFRSVQNGLVQHYALSMLFGVFVLIAAGHFVLGLY |
Ga0364946_159105_1_144 | 3300033815 | Sediment | NLTAFLLENLSYGFRAAQSGLVQHYALSMMIGLFLMIAAGRFVLGLY |
Ga0373899_016021_16_174 | 3300034077 | Sediment Slurry | VDGAVNLTAFLLDNLSYAFRAVQGGLVQGYALSMLIGLFLLIAAGRFLLGLY |
Ga0364938_096392_455_565 | 3300034114 | Sediment | LSYVFRAVQNGLVQHYALTMLIIVLFMIGAARWIPY |
Ga0364935_0055772_1021_1158 | 3300034151 | Sediment | TAFLLDNLSYVFRAVQNGLVQSYALSMLIGVFLLIAAGHWILGLY |
Ga0364923_0195718_400_540 | 3300034690 | Sediment | LTAFVLDNLSYAFRAVQNGLVQNYALSMLIGLFLLIAAGRFLLGLY |
⦗Top⦘ |