NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105152

Metagenome / Metatranscriptome Family F105152

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105152
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 60 residues
Representative Sequence MSREYCRVDDCPSYDYSDYEDNTGYYTPYDSREVDYDPIEQPEMYKRLKEVKTRLGVKQD
Number of Associated Samples 78
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 92.00 %
% of genes near scaffold ends (potentially truncated) 17.00 %
% of genes from short scaffolds (< 2000 bps) 81.00 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (45.000 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(65.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(91.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.67%    β-sheet: 3.33%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00145DNA_methylase 5.00
PF13155Toprim_2 2.00
PF11753DUF3310 1.00
PF14236DUF4338 1.00
PF00476DNA_pol_A 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 5.00
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.00 %
UnclassifiedrootN/A15.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10017544All Organisms → Viruses → Predicted Viral3543Open in IMG/M
3300000116|DelMOSpr2010_c10067274All Organisms → Viruses → Predicted Viral1473Open in IMG/M
3300004097|Ga0055584_100694109All Organisms → Viruses → Predicted Viral1064Open in IMG/M
3300004113|Ga0065183_10738749Not Available519Open in IMG/M
3300004951|Ga0068513_1021447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.694Open in IMG/M
3300005057|Ga0068511_1002283All Organisms → Viruses → Predicted Viral2071Open in IMG/M
3300006484|Ga0070744_10220860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.537Open in IMG/M
3300006793|Ga0098055_1051019All Organisms → Viruses → Predicted Viral1670Open in IMG/M
3300006810|Ga0070754_10076888All Organisms → Viruses → Predicted Viral1692Open in IMG/M
3300006810|Ga0070754_10115267All Organisms → Viruses → Predicted Viral1314Open in IMG/M
3300006810|Ga0070754_10176572All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300006810|Ga0070754_10405546Not Available596Open in IMG/M
3300006916|Ga0070750_10013506All Organisms → Viruses → Predicted Viral4257Open in IMG/M
3300006916|Ga0070750_10060263All Organisms → Viruses → Predicted Viral1818Open in IMG/M
3300006916|Ga0070750_10100243All Organisms → Viruses → Predicted Viral1343Open in IMG/M
3300006916|Ga0070750_10104846All Organisms → Viruses → Predicted Viral1308Open in IMG/M
3300006919|Ga0070746_10232844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.866Open in IMG/M
3300006920|Ga0070748_1243635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.648Open in IMG/M
3300006922|Ga0098045_1117505Not Available621Open in IMG/M
3300006924|Ga0098051_1087428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.841Open in IMG/M
3300006925|Ga0098050_1115689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.681Open in IMG/M
3300007276|Ga0070747_1352625Not Available503Open in IMG/M
3300007345|Ga0070752_1037725All Organisms → Viruses → Predicted Viral2303Open in IMG/M
3300007539|Ga0099849_1170609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.832Open in IMG/M
3300007539|Ga0099849_1226936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.694Open in IMG/M
3300007640|Ga0070751_1240779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.690Open in IMG/M
3300007653|Ga0102868_1140425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.571Open in IMG/M
3300007716|Ga0102867_1057302All Organisms → Viruses → Predicted Viral1027Open in IMG/M
3300008012|Ga0075480_10268945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.875Open in IMG/M
3300009050|Ga0102909_1110666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.665Open in IMG/M
3300009052|Ga0102886_1264412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.504Open in IMG/M
3300009054|Ga0102826_1175038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.512Open in IMG/M
3300009079|Ga0102814_10252173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.960Open in IMG/M
3300009543|Ga0115099_10902984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.570Open in IMG/M
3300010149|Ga0098049_1107985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.869Open in IMG/M
3300010296|Ga0129348_1160364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.776Open in IMG/M
3300010392|Ga0118731_108314819All Organisms → Viruses → Predicted Viral1370Open in IMG/M
3300010430|Ga0118733_104398627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.752Open in IMG/M
3300013134|Ga0116697_1009056All Organisms → Viruses → Predicted Viral1498Open in IMG/M
3300017709|Ga0181387_1016163All Organisms → Viruses → Predicted Viral1443Open in IMG/M
3300017709|Ga0181387_1127183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.525Open in IMG/M
3300017710|Ga0181403_1035901All Organisms → Viruses → Predicted Viral1043Open in IMG/M
3300017714|Ga0181412_1037755All Organisms → Viruses → Predicted Viral1271Open in IMG/M
3300017719|Ga0181390_1018353All Organisms → Viruses → Predicted Viral2321Open in IMG/M
3300017724|Ga0181388_1015543All Organisms → Viruses → Predicted Viral1931Open in IMG/M
3300017726|Ga0181381_1066861Not Available775Open in IMG/M
3300017726|Ga0181381_1086947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.666Open in IMG/M
3300017727|Ga0181401_1069310Not Available934Open in IMG/M
3300017728|Ga0181419_1147923Not Available563Open in IMG/M
3300017731|Ga0181416_1066512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.852Open in IMG/M
3300017735|Ga0181431_1009257All Organisms → Viruses → Predicted Viral2378Open in IMG/M
3300017743|Ga0181402_1035975All Organisms → Viruses → Predicted Viral1366Open in IMG/M
3300017753|Ga0181407_1023647All Organisms → Viruses → Predicted Viral1683Open in IMG/M
3300017755|Ga0181411_1108452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.817Open in IMG/M
3300017762|Ga0181422_1157882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.693Open in IMG/M
3300017772|Ga0181430_1003601All Organisms → cellular organisms → Bacteria5905Open in IMG/M
3300017772|Ga0181430_1108714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage821Open in IMG/M
3300017773|Ga0181386_1004738All Organisms → Viruses → Predicted Viral4828Open in IMG/M
3300017773|Ga0181386_1011315All Organisms → Viruses → Predicted Viral3027Open in IMG/M
3300017782|Ga0181380_1014282All Organisms → Viruses → Predicted Viral3015Open in IMG/M
3300017782|Ga0181380_1107715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.964Open in IMG/M
3300017783|Ga0181379_1102013All Organisms → Viruses → Predicted Viral1050Open in IMG/M
3300018416|Ga0181553_10212496All Organisms → Viruses → Predicted Viral1112Open in IMG/M
3300018416|Ga0181553_10476442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.669Open in IMG/M
3300018416|Ga0181553_10531401Not Available626Open in IMG/M
3300018417|Ga0181558_10701785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.515Open in IMG/M
3300018420|Ga0181563_10131121All Organisms → Viruses → Predicted Viral1599Open in IMG/M
3300018420|Ga0181563_10172244All Organisms → Viruses → Predicted Viral1342Open in IMG/M
3300018420|Ga0181563_10193607All Organisms → Viruses → Predicted Viral1245Open in IMG/M
3300018420|Ga0181563_10433950Not Available745Open in IMG/M
3300018642|Ga0188867_1006320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.596Open in IMG/M
3300020169|Ga0206127_1133192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.987Open in IMG/M
3300020176|Ga0181556_1104711All Organisms → Viruses → Predicted Viral1271Open in IMG/M
3300021335|Ga0213867_1002398Not Available8282Open in IMG/M
3300021356|Ga0213858_10015546All Organisms → Viruses → Predicted Viral3607Open in IMG/M
3300021356|Ga0213858_10016560All Organisms → Viruses → Predicted Viral3496Open in IMG/M
3300021356|Ga0213858_10021064All Organisms → Viruses → Predicted Viral3112Open in IMG/M
3300021373|Ga0213865_10094228All Organisms → Viruses → Predicted Viral1605Open in IMG/M
3300021373|Ga0213865_10220188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.927Open in IMG/M
3300021375|Ga0213869_10002393Not Available13003Open in IMG/M
3300022068|Ga0212021_1089732Not Available631Open in IMG/M
3300022074|Ga0224906_1002300Not Available8803Open in IMG/M
3300022178|Ga0196887_1137168Not Available511Open in IMG/M
3300022308|Ga0224504_10140480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.990Open in IMG/M
(restricted) 3300024059|Ga0255040_10176230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.869Open in IMG/M
3300024343|Ga0244777_10879617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.524Open in IMG/M
3300024346|Ga0244775_10138442All Organisms → Viruses → Predicted Viral2057Open in IMG/M
3300025070|Ga0208667_1041142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.779Open in IMG/M
3300025151|Ga0209645_1212987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.562Open in IMG/M
3300025570|Ga0208660_1024030All Organisms → Viruses → Predicted Viral1750Open in IMG/M
3300025645|Ga0208643_1176086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.522Open in IMG/M
3300025652|Ga0208134_1122833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.687Open in IMG/M
3300025759|Ga0208899_1016887All Organisms → Viruses → Predicted Viral3776Open in IMG/M
3300025769|Ga0208767_1025447All Organisms → Viruses → Predicted Viral3166Open in IMG/M
3300025853|Ga0208645_1052351All Organisms → Viruses → Predicted Viral1937Open in IMG/M
3300032274|Ga0316203_1046633All Organisms → Viruses → Predicted Viral1249Open in IMG/M
3300032277|Ga0316202_10132431All Organisms → Viruses → Predicted Viral1156Open in IMG/M
3300032277|Ga0316202_10395080Not Available646Open in IMG/M
3300032373|Ga0316204_10710212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.728Open in IMG/M
3300034375|Ga0348336_048013All Organisms → Viruses → Predicted Viral1789Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous25.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater25.00%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh9.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine7.00%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat4.00%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water2.00%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.00%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine1.00%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.00%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.00%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.00%
Beach SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004113Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)EnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007653Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009052Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300013134Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S3EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018642Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1001754433300000116MarineMSREYCRIDDDPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRGITK*
DelMOSpr2010_1006727433300000116MarineMNREYCRIDDDPSYDYSDYEDKTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKQDD*
Ga0055584_10069410913300004097Pelagic MarineMNTHREWEQRIMSREYCRIDDCPSYDFSDYEDSKGYYTPYDDREVDYDPIDKVEMRERLKEVKQRR
Ga0065183_1073874923300004113Pelagic MarineMSREYCRVDDCPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRLKEVKTRLGVKQDD*
Ga0068513_102144723300004951Marine WaterMNREYCRVDDCPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKQDD*
Ga0068511_100228393300005057Marine WaterMNREYCRVDDCPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKEDD*
Ga0070744_1022086023300006484EstuarineMGNDYCRIEDDSSYDYSDYDEGKGYYEPYKEKDEPDYDPIEQPEMAERLKEVKQRRGITDD*
Ga0098055_105101953300006793MarineMSREYCRVDDCPSYDYNDYEDNTGYYTPYDSREVDYDPIEQPEMYKRLKEVKTRLGVKQND*
Ga0070754_1007688883300006810AqueousMNTHREWEQMTMAREYCRIDDDPSYDFSDYEDNTGYYSPYDNREADYDPIDKVEMRERLMEVKQRRGITK*
Ga0070754_1011526743300006810AqueousMSREYCRVDDCPSYDYSDYEDNTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKQDD*
Ga0070754_1017657253300006810AqueousMSREYCRVDDCPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKQDD*
Ga0070754_1040554633300006810AqueousMSREYCRVDDCPTYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRLKEVK
Ga0070750_10013506133300006916AqueousMGREYCRVDDCPSYDYSDYEDSTGYYTPHDSREVDYDPIEQPEMYKRLKEVKTRLGVKQDD*
Ga0070750_1006026383300006916AqueousMSREYCRVDDCPSYDYSDYEDKTGYYTPYDSREVDYDPIEQPEMYKRLKEVKTRLGVKQDD*
Ga0070750_1010024313300006916AqueousMNREYCRVDDCPSYDYSDYEDSTGYYTPHDDSEVDYDPIEQPEMYKRIKEVKTRLGVKQDD*
Ga0070750_1010484653300006916AqueousMSREYCRVDDCPSYDYSDYEDNTGYYTPHDDREVDYDPIEQPEMYKRIKEVKTRLGVKQDD*
Ga0070746_1023284443300006919AqueousMNREYCRVDDCPSYDYSDYEDNTGYYTPHDDREVDYDPIEQPEMYKRIKEVKTRLGVKQDD*
Ga0070748_124363523300006920AqueousMSREYCRVDDCPSYDYSAYEDSTGYYTQHDSGEEDYDPIEQPEIHKRLKEVKTRLGVKQDD*
Ga0098045_111750533300006922MarineMSREYCRVDDDPSYDYSDYEDKTGYYTPYDSREVDYDPIEQPEMHKRLKEVKTRLGVKQDD*
Ga0098051_108742833300006924MarineMNTHREWEQRIMSREYCRIDDCPSYDFSDYEDSKGYYTPYDDREVDYDPIDKVEMRERLKEVKQRRGITND*
Ga0098050_111568933300006925MarineMSREYCRVDDDPSYDYSDYEDKTGYYTPYDSREVDYDPIEQPEMYKRLKEVKTRLGVKQDD*
Ga0070747_135262533300007276AqueousMSREYCRVDDCPSYDYSAYEDSTGYYTQHDSGEEDYDPIEQPEIHKRLKEVK
Ga0070752_103772553300007345AqueousMSREYCRVDDDPSYDYSDYEEQKGYYEPYKEAEDPDYDPIDKVEMRERVEEVKQRRGITDD*
Ga0099849_117060923300007539AqueousMTMAREYCRIDDCPSYDFSDYEEQRGYYKPYKEVEEPDYEPIDEVEMRERIKEVKTRLGVTE*
Ga0099849_122693633300007539AqueousMTMSREYCRIDDDPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRGITK*
Ga0070751_124077933300007640AqueousMNREYCRVDDCPSYDYSDYEDKTGYYTSHDDREVDYDPIEQPEMHKRLKEVKTRLGVKQDD*
Ga0102868_114042523300007653EstuarineMSREYCRVDDDPSYDYSDYDEQKGYYEPYKEIEPDYDPIDKVEMRERLEEVKTRLGVKQDD*
Ga0102867_105730233300007716EstuarineMGNDYCRIEDDSSYDYSDYDEGKGYYEPYKEKDEPDYDPIEHLEMAERLKEVKQRRGITDD*
Ga0075480_1026894533300008012AqueousMTMSREYCRIDDDPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRGITND*
Ga0102909_111066623300009050EstuarineMSREYCRVDDDPSYDYSDYDEQKGYYEPYKEAEPDYDPIDKVEMRERLEEVKTRLGVKQDD*
Ga0102886_126441223300009052EstuarineMSNDYCRIEDDSSYDYSDYDEGKGYYEPYKEKDEPDYDPIEQPEMAERLKEVKQRRGITDD*
Ga0102826_117503833300009054EstuarineCRIEDDSSYDYSDYDEGKGYYEPYKEKDEPDYDPIEQPEMAERLKEVKQRRGITDD*
Ga0102814_1025217323300009079EstuarineMSREYCRIDDDPSYDFSDYEDNTGYYTPYDDREVDYDPIDKVEMRERLKEVKQRRGITK*
Ga0115099_1090298423300009543MarineMSREYCRVDDDPSYDYSDYDEQKGYYEPYKEAEPDYDPIDKVEMRERIKEVKTRLGAKYND*
Ga0098049_110798523300010149MarineMSREYCRVDDCPSYDYNDYEDNTGYYTPYDSREVDYDPIEQPEMYKRLKEVKTRLGVKQDD*
Ga0129348_116036423300010296Freshwater To Marine Saline GradientMSREYCRIDDCPSYDFSDYEEQRGYYKPYKEVEEPDYEPIDEVEMRERIKEVKTRLGVTE
Ga0118731_10831481913300010392MarineMGREYCRIDDDPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRG
Ga0118733_10439862723300010430Marine SedimentMSREYCRVDDCPSYDYSDYEDNTGYYTSHDDREVDYDPIEQPEMHKRLKEVKTRLGVKQDD*
Ga0116697_100905633300013134Beach SandMNREYCRVDDDPSYDYSDYVEQRGYYEPYKEAEEPDYDPIDEEEMRERIKEVKTRLGVKQDD*
Ga0181387_101616343300017709SeawaterMAREYCRIDDDPSYDFSDYEDNTGYYTPYDDREVDYDPIDKVEMRERLKEVKQRRGITND
Ga0181387_112718323300017709SeawaterMSREYCRVDDDPSYDYSDYEEQKGYYEPYKEAEEPDYDPIDKVEMRERIKEVKQRRGITD
Ga0181403_103590163300017710SeawaterMSREYCRVDDCPSYDYSDYEDNTGYYTPYDSREVDYDPIEQPEMYKRLKEVKTRLGVKQD
Ga0181412_103775573300017714SeawaterMAREYCRIDDDPSYDFSDYEDNTGYYTPYDDREVDYDPIEQPEMYKRIKEVKTRLGVKQD
Ga0181390_101835333300017719SeawaterMSREYCRIDDDPSYDFSDYEDNTGYYTPYDDREVEYDPIDKVEMRERLKEVKQRRGITND
Ga0181388_101554353300017724SeawaterMSREYCRIDDDPSYDFSDYEDNTGYYTPYDDREVDYDPIDKVEMRERLKEVKQRRGITND
Ga0181381_106686153300017726SeawaterMSREYCRVDDCPSYDYSDYEDNTGYYTPYDSREVDYDPIEQPEMYKRLKEVKT
Ga0181381_108694723300017726SeawaterMSREYCRVDDDPSYDYSDYDEQKGYYEPYKEIEPDYDPIDKVEMRERIEEVKTRLGVKQD
Ga0181401_106931013300017727SeawaterMAREYCRIDDDPSYDFSDYEDNTGYYSPYDDREVDYDPIDKVEMRERLKEVKQRRGITND
Ga0181419_114792333300017728SeawaterMAREYCRIDDDPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRGIT
Ga0181416_106651223300017731SeawaterMNREYCRIDDDPSYDYSDYDEQKGYYEPYKEAEEPDYDPIDKVEMRERIEEVKQRRGITD
Ga0181431_100925783300017735SeawaterMSREYCRVDDDPSYDYSDYDEQKGYYEPYKEAEPDYDPIDKVEMRERIKEVKQRRGITDD
Ga0181402_103597533300017743SeawaterMSREYCRVDDCPSYDYSDYEEQKGYYESYKEAEEPDYDPIDNVEMYERLKEVKQRRGITD
Ga0181407_102364773300017753SeawaterMSREYCRIDDDPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRGIT
Ga0181411_110845233300017755SeawaterMSREYCRIDDDPSYDYSDYEEQKGYYESYKEAEEPDYDPIDNVEMYERLKEVKQRRGITD
Ga0181422_115788213300017762SeawaterREYCRIDDCPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLKEVKQRRGITND
Ga0181430_1003601123300017772SeawaterMSREYCRVDDDPSYDYSDYDEQKGYYEPYKEAEPDYDPIDKVEMRERIKEVKTRLGAKYN
Ga0181430_110871413300017772SeawaterYCRVDDDPSYDYSDYDEQKGYYEPYKEAEEPDYDPIDKVEMRERIEEVKTRLGVKKDD
Ga0181386_100473853300017773SeawaterMSREYCRVDDDPSYDYSDYEEQKGYYKPYKEAEEPDYDPIDKVEMRERIKEVKQRRGITD
Ga0181386_101131533300017773SeawaterMAREYCRIDDCPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRGITDD
Ga0181380_101428243300017782SeawaterMNREYCRVDDDPSYDYSDYEDKTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKQD
Ga0181380_110771533300017782SeawaterMSREYCRVDDDPSYDYSDYDEQKGYYEPYKEAEPDYDPIDKVEMRERIEEVKTRLGVKQN
Ga0181379_110201333300017783SeawaterMSREYCRIDDDPSYDFNDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRGITND
Ga0181553_1021249643300018416Salt MarshEQMTMAREYCKIDDCPSYDFSDYEDSKGYYTPYDDREVDYDPIDKVEMRERIKEVKTRLGVKQDD
Ga0181553_1047644223300018416Salt MarshMAREYCRIDDCPSYDFSDYEDKTGYYTPYDDREVDYDPIDKVEMRERLKEVKTRLGVTE
Ga0181553_1053140113300018416Salt MarshMAREYCRIDDCPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKQD
Ga0181558_1070178513300018417Salt MarshGLATHTHNKWEQMTMAREYCRIDDCPSYDFSDYEDKTGYYTPYDDREVDYDPIDKVEMRERIKEVKTRLGVKQDD
Ga0181563_1013112153300018420Salt MarshIDDCPSYDFSDYEDSKGYYTPYDDREVDYDPIDKVEMRERLKEVKTRLGVSTND
Ga0181563_1017224433300018420Salt MarshMAREYCKIDDCPSYDFSDYEDSKGYYTPYDDREVDYDPIDKVEMRERIKEVKTRLGVKQD
Ga0181563_1019360753300018420Salt MarshMAREYCRIDDCPSYDFSDYEDNKGYYTPYDDREVDYDPIDKVEMRERIKEVKTRLGV
Ga0181563_1043395013300018420Salt MarshMAREYCRIDDCPSYDFSDYEDKTGYYTPYDDREVDYDPIDKVEMRERLKEVKTRLGVSTN
Ga0188867_100632033300018642Freshwater LakeMNREYCRVDDCPSYDYSDYEDNTGYYTPNDSREVDYDPIEQPEMYKRLKEVKTRLGVKQD
Ga0206127_113319233300020169SeawaterMSREYCRVDDDPSYDYSNYEDKTGYYTPHDDREVDYDPIEQPEMHKRLKEVKTRLGVKQD
Ga0181556_110471143300020176Salt MarshMAREYCRIDDCPSYDFSDYEDNKGYYTPYDDREVDYDPIDKVEMRERIKEVKTRLGVTE
Ga0213867_100239833300021335SeawaterMNREYCRVDDCPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKED
Ga0213858_10015546123300021356SeawaterMSREYCRVDDCPSYDYSDYEDSTGYYTPHDDREVDYDPIEQPEMYKRLKEVKTRLGVKQD
Ga0213858_10016560113300021356SeawaterMSREYCRVDDCPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMHKRLKEVKNRLGVK
Ga0213858_1002106433300021356SeawaterMSREYCRVDDCPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKQD
Ga0213865_1009422833300021373SeawaterMAREYCRIDDCPSYDFSDYEEQRGYYKPYKEVEEPDYEPIDEVEMRERIKEVKTRLGVTE
Ga0213865_1022018833300021373SeawaterMSREYCRIDDCPSYDFSDYEDSKGYYTPYDDREVDYDPIDKVEMRERIKEVKQRRGITE
Ga0213869_10002393173300021375SeawaterMGNDYCRIEDDSSYDYSDYDEGKGYYEPYKEKDEPDYDPIEQPEMAERLKEVKQRRGITD
Ga0212021_108973213300022068AqueousMNREYCRVDDCPSYDYSDYEDSTGYYTPHDDSEVDYDPIEQPEMYKRIKEVKTRL
Ga0224906_100230063300022074SeawaterMSREYCRVDDCPSYDYSDYEDSTGYYTPYDDREVDYDPIEQPEMYKRLKEVKTRLGVKQD
Ga0196887_113716823300022178AqueousMSREYCRVDDCPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRLKEVKTRLGVKQD
Ga0224504_1014048043300022308SedimentMSREYCRIDDDPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLKEVKQRRGITND
(restricted) Ga0255040_1017623033300024059SeawaterMSREYCRIDDDPSYDYSDYDEQKGYYEPYKEAEPDYDPIDKVEMRERLMEVKQRRGITND
Ga0244777_1087961723300024343EstuarineMSREYCRVDDDPSYDYSDYDEQKGYYEPYKEIEPDYDPIDKVEMRERLEEVKTRLGVKQD
Ga0244775_1013844263300024346EstuarineMGNDYCRIEDDSSYDYSDYDESKGYYEPYKEKDEPDYDPIEQPEMAERLKEVKQRRGITD
Ga0208667_104114233300025070MarineMSREYCRVDDCPSYDYNDYEDNTGYYTPYDSREVDYDPIEQPEMYKRLKEVKTRLGVKQN
Ga0209645_121298733300025151MarinePSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKQDD
Ga0208660_102403043300025570AqueousMSREYCRVDDCPSYDYSDYEDNTGYYTSHDDREVDYDPIEQPEMHKRLKEVKTRLGVKQD
Ga0208643_117608623300025645AqueousMSREYCRVDDCPSYDYSAYEDSTGYYTQHDSGEEDYDPIEQPEIHKRLKEVKTRLGVKQD
Ga0208134_112283333300025652AqueousMNREYCRVDDDPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEIHKRLKEVKTRLGVKQD
Ga0208899_101688733300025759AqueousMGREYCRVDDCPSYDYSDYEDSTGYYTPHDSREVDYDPIEQPEMYKRLKEVKTRLGVKQD
Ga0208767_102544743300025769AqueousMSREYCRVDDCPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRIKEVKTRLGVKED
Ga0208645_105235183300025853AqueousMNTHREWEQMTMAREYCRIDDDPSYDFSDYEDNTGYYSPYDNREADYDPIDKVEMRERLMEVKQRRGITK
Ga0316203_104663323300032274Microbial MatMSREYCRIDDDPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRGITND
Ga0316202_1013243133300032277Microbial MatMSREYCKVDDDPSYDYSDYEDSTGYYTPYDSREVDYDPIEQPEMYKRLKEVKTRLGVKED
Ga0316202_1039508013300032277Microbial MatMNTHREWEQMTMSREYCRIDDCPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRGITK
Ga0316204_1071021233300032373Microbial MatMSREYCRIDDDPSYDFSDYEDNTGYYSPHDNREADYDPIDKVEMRERLMEVKQRRGITK
Ga0348336_048013_597_7823300034375AqueousMSREYCRVDDCPSYDYSDYEDNTGYYTPHDDREVDYDPIEQPEMYKRIKEVKTRLGVKQD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.