NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BEDJCVIAssemblies_1105430059177

Scaffold BEDJCVIAssemblies_1105430059177


Overview

Basic Information
Taxon OID2012990007 Open in IMG/M
Scaffold IDBEDJCVIAssemblies_1105430059177 Open in IMG/M
Source Dataset NameHot spring microbial communities from Beowulf East Transect D, Yellowstone National Park, USA - YSTONE2 (BED)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)814
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.731451Long. (o)-110.7113131Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033507Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
BEDJCVIAssemblies_119600F033507N/ACLDYGDGYGGVLLSPQYLTTFLSGFTLIVFMARSKVVGVATSTTSTEGTLTVNLSVTSGSGVIQQGSVYYLNPVLNGYYYCGLQMGNQSVQYDWTLNISATPTSLASGVTVFVEITYFDTLPNKPYYTETWAFTLNSNGQASGEFSVCMVPVTIFPESSVGIKVTSVKLASDQPISYTSSGITIIPED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.