NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold YNP8_C4007

Scaffold YNP8_C4007


Overview

Basic Information
Taxon OID2013515001 Open in IMG/M
Scaffold IDYNP8_C4007 Open in IMG/M
Source Dataset NameHot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - YNP8 OSP Spring
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2616
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, WY
CoordinatesLat. (o)44.733519Long. (o)-110.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013613Metagenome / Metatranscriptome269Y
F077496Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
YNP8_104540F077496N/AVARLSAPQEEVGARLGRRKKWSGDAVIMTIYIPLDIKKELEARAVARRKSLSEYAVGLILKGLEAEEAERSAKAEEVP
YNP8_104550F013613N/AVSRETYGRIVGLARSRGLSVSEVVEELLTRGLEGSVAVAADPPDPPEDSLQGALKGLEPLEREKVLQFMKGLEDAEAKLAKLGPYVKQQANTWRFTLQDIMNQQEVTKLRDTVFNLRHTYEKKIKRIVRDPTALNMIGERLLRLMKELGVPT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.