Scaffold YNP14_C104

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold YNP14_C104

Scaffold YNP14_C104

Overview

Basic Information
Taxon OID	2013954001 Open in IMG/M
Scaffold ID	YNP14_C104 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - YNP14 OSP Spring
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1311
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Yellowstone National Park, WY
Coordinates	Lat. (^o)	44.733473	Long. (^o)	-110.70007	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031931	Metagenome	181	N

Sequences

Protein ID	Family	RBS	Sequence
YNP14_03540	F031931	N/A	VSSTIYPFKVADAIPISLGLTATQGGVQLSQGYINLYSQILAETDSAVFHAIIYSELVPFQSSRLVESISPIISLESLIKVLQQQDNIQPQLYGAVEQALLPPGVTLCTPQSITSGSVSGETVKENIDVQYASCLPPEGLNFDEINMTPYVGFPPINQTDEITVSYSLSVK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.