Scaffold YNP19_FZTS9854_b1

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold YNP19_FZTS9854_b1

Scaffold YNP19_FZTS9854_b1

Overview

Basic Information
Taxon OID	2015219000 Open in IMG/M
Scaffold ID	YNP19_FZTS9854_b1 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP19 Cistern Spring
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	784
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Yellowstone National Park, WY
Coordinates	Lat. (^o)	44.7230812	Long. (^o)	-110.7040247	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079395	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
YNP19240400	F079395	GAGG	MSIRPSEEFELTPIMRKTISAMLEGVIVALTRLGYLEQDRANELIEKLNTDALNVGQLRLLTDVVI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.