Basic Information | |
---|---|
Taxon OID | 2016842004 Open in IMG/M |
Scaffold ID | YNP18_C4039 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP18 Washburn Springs #1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5831 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (37.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1 | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, WY | |||||||
Coordinates | Lat. (o) | 44.7649458 | Long. (o) | -110.4303679 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000750 | Metagenome / Metatranscriptome | 908 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
YNP18_240000 | F000750 | GGAG | MYLSVAITAFLFSYWFFKKKFRAKPLQLPINVETGDVIHGAFGSLLANLSLHQMYIDVMVGVLLYLAYQFTEFAVKQDAVYKDIATFTAGYFGTIIAGGIPL |
⦗Top⦘ |