Basic Information | |
---|---|
Taxon OID | 2016842008 Open in IMG/M |
Scaffold ID | YNP20_C11411 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP20 Bath Lake Vista Annex - Purple-Sulfur Mats |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2101 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, WY | |||||||
Coordinates | Lat. (o) | 44.96507 | Long. (o) | -110.71215 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F060939 | Metagenome / Metatranscriptome | 132 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
YNP20_56530 | F060939 | N/A | MLWRLRVWFQDASGTTSYTGAWLRSPNETAIFAFVDALRGLSNAQITHVDISRRFPYTSQVPSGRDRGVAMFVQPAYNPDAPGVVSDAFPMWVPESELYAVRDLWGYPITVRGFVSRAGYNMDEVVPEDGEPQSLDNEYPDSTDDYYLVAIRRNFWHRLLRDARAYNTLSMTLPDEKARRVRLDIRDLFLGVPMREV |
⦗Top⦘ |