 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 2020350001 Open in IMG/M |
| Scaffold ID | VrWwTxAD_contig53608 Open in IMG/M |
| Source Dataset Name | Viral communities in wastewater treatment process (AD) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Illinois, Urbana-Champaign |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6571 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (91.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore: Singapore | |||||||
| Coordinates | Lat. (o) | 1.332 | Long. (o) | 103.756 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058971 | Metagenome / Metatranscriptome | 134 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| AD_204940 | F058971 | GGGGG | MTPNLIINLDIEPITLMWNGQAISLPGTYELVPDEMVKHLHRRVMAIALHERKRIPFCGRLVGQAKSGKGSVWLIEDDRGQLIKSQKPMVIEGGKEG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |