NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold YNPsite14_CeleraDRAF_47405

Scaffold YNPsite14_CeleraDRAF_47405


Overview

Basic Information
Taxon OID2022920007 Open in IMG/M
Scaffold IDYNPsite14_CeleraDRAF_47405 Open in IMG/M
Source Dataset NameHot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - YNP14 OSP Spring
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)631
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, WY
CoordinatesLat. (o)44.733473Long. (o)-110.70007Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006070Metagenome / Metatranscriptome382N
F059131Metagenome134N

Sequences

Protein IDFamilyRBSSequence
YNPsite14_CeleraDRAFT_48320F006070AGGMTLYPYLVVDLPITDTNTHTYRTNPFNPLTPTQPGISLIRLGESVPPIRAFNIYVYNYANAALSVQVIANENAKNYQYGALLDGLDYQSESGYPDFNVGSPFTVPAGSTSAPSVQAIQSDFYTSAAE
YNPsite14_CeleraDRAFT_48330F059131N/APRLPFYQSIKIEIVPRNQPALITGFAANIIEIYDVNLFKESVKEFFESITPSSTLPVATSGVPPKFVAEEVVSARLPVKVT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.