NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold YNPsite14_CeleraDRAF_scf1118686615366

Scaffold YNPsite14_CeleraDRAF_scf1118686615366


Overview

Basic Information
Taxon OID2022920007 Open in IMG/M
Scaffold IDYNPsite14_CeleraDRAF_scf1118686615366 Open in IMG/M
Source Dataset NameHot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - YNP14 OSP Spring
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1085
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, WY
CoordinatesLat. (o)44.733473Long. (o)-110.70007Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021808Metagenome / Metatranscriptome217Y

Sequences

Protein IDFamilyRBSSequence
YNPsite14_CeleraDRAFT_101490F021808N/AMTEEPPYGTIAWYFFEIDERQRQIYELVFDIDQKIAKVKDLLNEIDILKAQLETNVNVGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.