Scaffold YNPsite19_CeleraDRAF_scf1118685652517

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold YNPsite19_CeleraDRAF_scf1118685652517

Scaffold YNPsite19_CeleraDRAF_scf1118685652517

Overview

Basic Information
Taxon OID	2022920017 Open in IMG/M
Scaffold ID	YNPsite19_CeleraDRAF_scf1118685652517 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP19 Cistern Spring
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1773
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Yellowstone National Park, WY
Coordinates	Lat. (^o)	44.7230812	Long. (^o)	-110.7040247	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051572	Metagenome / Metatranscriptome	144	N

Sequences

Protein ID	Family	RBS	Sequence
YNPsite19_CeleraDRAFT_125620	F051572	N/A	VHGGPFADVRTLADVVLEGGCKRSLQFLKARLDLCVLAALVKAVPAGSMVKLRPGLVWRLAEELAAAAGRDRERVRNSLLKRAGEVLARLRREMGDKAPAEAFLARLAELFLEELEA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.