NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FACEOR_FYWIORV02G3202

Scaffold FACEOR_FYWIORV02G3202


Overview

Basic Information
Taxon OID2032320006 Open in IMG/M
Scaffold IDFACEOR_FYWIORV02G3202 Open in IMG/M
Source Dataset NameSoil microbial communities from sample at FACE Site 5 Oak Ridge CO2+
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location NameOak Ridge Integrated Field Research Center, Tennessee, USA
CoordinatesLat. (o)35.94106884Long. (o)-84.4Alt. (m)Depth (m).05
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077714Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
FACEORE_2985050F077714N/AFEGPPRSERDIMLLAAMRSNGSISGMCWIEGRACPRRYLSMLPSHVRANLFGSD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.